Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PP_4151-4152/excise(antitoxin)
Location 2806579..2807621 Replicon chromosome
Accession NZ_CP110353
Organism Pseudomonas aeruginosa strain PALA48

Toxin (Protein)


Gene name PP_4152 Uniprot ID -
Locus tag PALA48_RS13585 Protein ID WP_003153636.1
Coordinates 2807046..2807621 (+) Length 192 a.a.

Antitoxin (Protein)


Gene name PP_4151 Uniprot ID I3TV68
Locus tag PALA48_RS13580 Protein ID WP_003050245.1
Coordinates 2806579..2807049 (+) Length 157 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA48_RS13545 (PALA48_02687) 2801958..2803376 - 1419 WP_004350605.1 TIGR03752 family integrating conjugative element protein -
PALA48_RS13550 (PALA48_02688) 2803366..2804277 - 912 WP_004350604.1 TIGR03749 family integrating conjugative element protein -
PALA48_RS13555 (PALA48_02689) 2804274..2804966 - 693 WP_012614071.1 TIGR03746 family integrating conjugative element protein -
PALA48_RS13560 (PALA48_02690) 2804963..2805373 - 411 WP_003821108.1 TIGR03750 family conjugal transfer protein -
PALA48_RS13565 (PALA48_02691) 2805386..2805745 - 360 WP_003153634.1 TIGR03745 family integrating conjugative element membrane protein -
PALA48_RS13570 (PALA48_02692) 2805762..2805995 - 234 WP_003050225.1 TIGR03758 family integrating conjugative element protein -
PALA48_RS13575 (PALA48_02693) 2805992..2806375 - 384 WP_003090167.1 RAQPRD family integrative conjugative element protein -
PALA48_RS13580 (PALA48_02694) 2806579..2807049 + 471 WP_003050245.1 helix-turn-helix domain-containing protein Antitoxin
PALA48_RS13585 (PALA48_02695) 2807046..2807621 + 576 WP_003153636.1 PIN domain-containing protein Toxin
PALA48_RS13590 (PALA48_02696) 2807639..2808553 + 915 WP_003050256.1 AAA family ATPase -
PALA48_RS13595 (PALA48_02697) 2808550..2809020 + 471 WP_003153638.1 type III CBASS phage resistance system CD-NTase-associated protein Cap8 -
PALA48_RS13600 (PALA48_02698) 2809017..2809517 + 501 WP_003090159.1 type III CBASS phage resistance system CD-NTase-associated protein Cap7 -
PALA48_RS13605 (PALA48_02699) 2809517..2810419 + 903 WP_003153640.1 CBASS oligonucleotide cyclase -
PALA48_RS13610 (PALA48_02700) 2810458..2811183 + 726 WP_003050273.1 CBASS effector endonuclease NucC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2746031..2857148 111117


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-114)

Antitoxin

Helix-turn-helix domain, group 17

(85-133)


Sequences

Toxin        


Download         Length: 192 a.a.        Molecular weight: 21629.78 Da        Isoelectric Point: 5.9995

>T263693 WP_003153636.1 NZ_CP110353:2807046-2807621 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL

Download         Length: 576 bp

Antitoxin


Download         Length: 157 a.a.        Molecular weight: 17245.62 Da        Isoelectric Point: 6.3803

>AT263693 WP_003050245.1 NZ_CP110353:2806579-2807049 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE

Download         Length: 471 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB I3TV68

References