Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2806579..2807621 | Replicon | chromosome |
Accession | NZ_CP110353 | ||
Organism | Pseudomonas aeruginosa strain PALA48 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PALA48_RS13585 | Protein ID | WP_003153636.1 |
Coordinates | 2807046..2807621 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PALA48_RS13580 | Protein ID | WP_003050245.1 |
Coordinates | 2806579..2807049 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA48_RS13545 (PALA48_02687) | 2801958..2803376 | - | 1419 | WP_004350605.1 | TIGR03752 family integrating conjugative element protein | - |
PALA48_RS13550 (PALA48_02688) | 2803366..2804277 | - | 912 | WP_004350604.1 | TIGR03749 family integrating conjugative element protein | - |
PALA48_RS13555 (PALA48_02689) | 2804274..2804966 | - | 693 | WP_012614071.1 | TIGR03746 family integrating conjugative element protein | - |
PALA48_RS13560 (PALA48_02690) | 2804963..2805373 | - | 411 | WP_003821108.1 | TIGR03750 family conjugal transfer protein | - |
PALA48_RS13565 (PALA48_02691) | 2805386..2805745 | - | 360 | WP_003153634.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PALA48_RS13570 (PALA48_02692) | 2805762..2805995 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
PALA48_RS13575 (PALA48_02693) | 2805992..2806375 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
PALA48_RS13580 (PALA48_02694) | 2806579..2807049 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PALA48_RS13585 (PALA48_02695) | 2807046..2807621 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
PALA48_RS13590 (PALA48_02696) | 2807639..2808553 | + | 915 | WP_003050256.1 | AAA family ATPase | - |
PALA48_RS13595 (PALA48_02697) | 2808550..2809020 | + | 471 | WP_003153638.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PALA48_RS13600 (PALA48_02698) | 2809017..2809517 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PALA48_RS13605 (PALA48_02699) | 2809517..2810419 | + | 903 | WP_003153640.1 | CBASS oligonucleotide cyclase | - |
PALA48_RS13610 (PALA48_02700) | 2810458..2811183 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2746031..2857148 | 111117 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T263693 WP_003153636.1 NZ_CP110353:2807046-2807621 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT263693 WP_003050245.1 NZ_CP110353:2806579-2807049 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|