263691

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1450499..1451156 Replicon chromosome
Accession NZ_CP110353
Organism Pseudomonas aeruginosa strain PALA48

Toxin (Protein)


Gene name hicA Uniprot ID A0A8G3IXE4
Locus tag PALA48_RS06980 Protein ID WP_003098540.1
Coordinates 1450974..1451156 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag PALA48_RS06975 Protein ID WP_004351284.1
Coordinates 1450499..1450927 (-) Length 143 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA48_RS06940 (PALA48_01376) 1446512..1447216 + 705 WP_012613696.1 phage regulatory protein/antirepressor Ant -
PALA48_RS06945 (PALA48_01377) 1447281..1448114 + 834 WP_012613697.1 helix-turn-helix domain-containing protein -
PALA48_RS06950 (PALA48_01378) 1448101..1448898 + 798 WP_012613698.1 hypothetical protein -
PALA48_RS06955 (PALA48_01379) 1448895..1449101 + 207 WP_024082445.1 hypothetical protein -
PALA48_RS06960 (PALA48_01380) 1449098..1449679 + 582 WP_012613699.1 recombination protein NinG -
PALA48_RS06965 (PALA48_01381) 1449676..1449972 + 297 WP_024082446.1 hypothetical protein -
PALA48_RS06970 (PALA48_01382) 1449974..1450348 + 375 WP_004351286.1 antiterminator Q family protein -
PALA48_RS06975 (PALA48_01383) 1450499..1450927 - 429 WP_004351284.1 hypothetical protein Antitoxin
PALA48_RS06980 (PALA48_01384) 1450974..1451156 - 183 WP_003098540.1 type II toxin-antitoxin system HicA family toxin Toxin
PALA48_RS06985 (PALA48_01385) 1451357..1451671 + 315 WP_015649339.1 phage holin, lambda family -
PALA48_RS06990 (PALA48_01386) 1451671..1452288 + 618 WP_012613700.1 glycoside hydrolase family 19 protein -
PALA48_RS06995 1452309..1452758 + 450 WP_024082447.1 lysis system i-spanin subunit Rz -
PALA48_RS07000 (PALA48_01388) 1452755..1453498 + 744 WP_012613702.1 hypothetical protein -
PALA48_RS07005 (PALA48_01389) 1453618..1454163 + 546 WP_019486501.1 terminase small subunit -
PALA48_RS07010 (PALA48_01390) 1454135..1456099 + 1965 WP_012613704.1 phage terminase large subunit family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1433000..1475962 42962


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(7-78)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6746.86 Da        Isoelectric Point: 11.0775

>T263691 WP_003098540.1 NZ_CP110353:c1451156-1450974 [Pseudomonas aeruginosa]
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGKQTTFADHGAKEMPEPTRKAIIKQLGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 143 a.a.        Molecular weight: 15756.94 Da        Isoelectric Point: 4.6562

>AT263691 WP_004351284.1 NZ_CP110353:c1450927-1450499 [Pseudomonas aeruginosa]
MYDYAIRFEQDDSAPGVAVFCRDLPELNSYGDDKVHAIGEAVDAIESTLSLYVDQRREIPAASQAQPGERVIHLPAVTVA
KIALWNEMVRRDMRKADLCRLLGIAQTQGDRLVDFLHNTKMEAMENALSALGLRLSVNIEAA

Download         Length: 429 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References