Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 5309260..5309900 Replicon chromosome
Accession NZ_CP110352
Organism Pseudomonas aeruginosa strain PALA47

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PALA47_RS24625 Protein ID WP_003105740.1
Coordinates 5309260..5309670 (-) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID Q6X2S2
Locus tag PALA47_RS24630 Protein ID WP_003158175.1
Coordinates 5309670..5309900 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA47_RS24585 (PALA47_04871) 5305129..5305299 + 171 WP_003159716.1 hypothetical protein -
PALA47_RS24590 (PALA47_04872) 5305455..5306183 + 729 WP_003105754.1 TIGR03761 family integrating conjugative element protein -
PALA47_RS24595 (PALA47_04873) 5306189..5306737 + 549 WP_003105753.1 DUF3158 family protein -
PALA47_RS24600 (PALA47_04874) 5306784..5307623 + 840 WP_003105750.1 Rha family transcriptional regulator -
PALA47_RS24605 (PALA47_04875) 5307653..5308141 + 489 WP_003105748.1 single-stranded DNA-binding protein -
PALA47_RS24610 5308297..5308494 + 198 WP_003109353.1 CrpP family ICE-associated protein -
PALA47_RS24615 (PALA47_04876) 5308560..5308778 - 219 WP_003105747.1 hypothetical protein -
PALA47_RS24620 5308978..5309238 - 261 WP_003105742.1 hypothetical protein -
PALA47_RS24625 (PALA47_04878) 5309260..5309670 - 411 WP_003105740.1 tRNA(fMet)-specific endonuclease VapC Toxin
PALA47_RS24630 (PALA47_04879) 5309670..5309900 - 231 WP_003158175.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PALA47_RS24635 (PALA47_04880) 5310156..5312075 + 1920 WP_004352838.1 type I DNA topoisomerase -
PALA47_RS24640 5312383..5312592 + 210 WP_003105733.1 cold-shock protein -
PALA47_RS24645 (PALA47_04881) 5312813..5314702 + 1890 WP_003105732.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 5289803..5392986 103183


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin

SpoVT-AbrB domain

(7-35)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 15450.81 Da        Isoelectric Point: 7.3233

>T263688 WP_003105740.1 NZ_CP110352:c5309670-5309260 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8480.41 Da        Isoelectric Point: 4.2821

>AT263688 WP_003158175.1 NZ_CP110352:c5309900-5309670 [Pseudomonas aeruginosa]
MEQGSVFQSNRSQAVRLPKAVALPDDVKRVDVVVVGRARIITPAGESWDSWFDGEGVTADFMAEREQPADQERETF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB Q6X2S2

References