Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 4784883..4785540 | Replicon | chromosome |
| Accession | NZ_CP110351 | ||
| Organism | Pseudomonas aeruginosa strain PALA45 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A8G3IXE4 |
| Locus tag | PALA45_RS22295 | Protein ID | WP_003098540.1 |
| Coordinates | 4784883..4785065 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PALA45_RS22300 | Protein ID | WP_004351284.1 |
| Coordinates | 4785112..4785540 (+) | Length | 143 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA45_RS22265 (PALA45_04425) | 4779940..4781904 | - | 1965 | WP_012613704.1 | phage terminase large subunit family protein | - |
| PALA45_RS22270 (PALA45_04426) | 4781876..4782421 | - | 546 | WP_019486501.1 | terminase small subunit | - |
| PALA45_RS22275 (PALA45_04427) | 4782541..4783284 | - | 744 | WP_012613702.1 | hypothetical protein | - |
| PALA45_RS22280 | 4783281..4783730 | - | 450 | WP_024082447.1 | lysis system i-spanin subunit Rz | - |
| PALA45_RS22285 (PALA45_04429) | 4783751..4784368 | - | 618 | WP_012613700.1 | glycoside hydrolase family 19 protein | - |
| PALA45_RS22290 (PALA45_04430) | 4784368..4784682 | - | 315 | WP_015649339.1 | phage holin, lambda family | - |
| PALA45_RS22295 (PALA45_04431) | 4784883..4785065 | + | 183 | WP_003098540.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PALA45_RS22300 (PALA45_04432) | 4785112..4785540 | + | 429 | WP_004351284.1 | hypothetical protein | Antitoxin |
| PALA45_RS22305 (PALA45_04433) | 4785691..4786065 | - | 375 | WP_004351286.1 | antiterminator Q family protein | - |
| PALA45_RS22310 (PALA45_04434) | 4786067..4786363 | - | 297 | WP_024082446.1 | hypothetical protein | - |
| PALA45_RS22315 (PALA45_04435) | 4786360..4786941 | - | 582 | WP_012613699.1 | recombination protein NinG | - |
| PALA45_RS22320 (PALA45_04436) | 4786938..4787144 | - | 207 | WP_024082445.1 | hypothetical protein | - |
| PALA45_RS22325 (PALA45_04437) | 4787141..4787938 | - | 798 | WP_012613698.1 | hypothetical protein | - |
| PALA45_RS22330 (PALA45_04438) | 4787925..4788758 | - | 834 | WP_012613697.1 | helix-turn-helix domain-containing protein | - |
| PALA45_RS22335 (PALA45_04439) | 4788823..4789527 | - | 705 | WP_012613696.1 | phage regulatory protein/antirepressor Ant | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4760077..4803039 | 42962 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6746.86 Da Isoelectric Point: 11.0775
>T263683 WP_003098540.1 NZ_CP110351:4784883-4785065 [Pseudomonas aeruginosa]
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGKQTTFADHGAKEMPEPTRKAIIKQLGLK
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGKQTTFADHGAKEMPEPTRKAIIKQLGLK
Download Length: 183 bp
Antitoxin
Download Length: 143 a.a. Molecular weight: 15756.94 Da Isoelectric Point: 4.6562
>AT263683 WP_004351284.1 NZ_CP110351:4785112-4785540 [Pseudomonas aeruginosa]
MYDYAIRFEQDDSAPGVAVFCRDLPELNSYGDDKVHAIGEAVDAIESTLSLYVDQRREIPAASQAQPGERVIHLPAVTVA
KIALWNEMVRRDMRKADLCRLLGIAQTQGDRLVDFLHNTKMEAMENALSALGLRLSVNIEAA
MYDYAIRFEQDDSAPGVAVFCRDLPELNSYGDDKVHAIGEAVDAIESTLSLYVDQRREIPAASQAQPGERVIHLPAVTVA
KIALWNEMVRRDMRKADLCRLLGIAQTQGDRLVDFLHNTKMEAMENALSALGLRLSVNIEAA
Download Length: 429 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|