Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 4784883..4785540 Replicon chromosome
Accession NZ_CP110351
Organism Pseudomonas aeruginosa strain PALA45

Toxin (Protein)


Gene name hicA Uniprot ID A0A8G3IXE4
Locus tag PALA45_RS22295 Protein ID WP_003098540.1
Coordinates 4784883..4785065 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag PALA45_RS22300 Protein ID WP_004351284.1
Coordinates 4785112..4785540 (+) Length 143 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA45_RS22265 (PALA45_04425) 4779940..4781904 - 1965 WP_012613704.1 phage terminase large subunit family protein -
PALA45_RS22270 (PALA45_04426) 4781876..4782421 - 546 WP_019486501.1 terminase small subunit -
PALA45_RS22275 (PALA45_04427) 4782541..4783284 - 744 WP_012613702.1 hypothetical protein -
PALA45_RS22280 4783281..4783730 - 450 WP_024082447.1 lysis system i-spanin subunit Rz -
PALA45_RS22285 (PALA45_04429) 4783751..4784368 - 618 WP_012613700.1 glycoside hydrolase family 19 protein -
PALA45_RS22290 (PALA45_04430) 4784368..4784682 - 315 WP_015649339.1 phage holin, lambda family -
PALA45_RS22295 (PALA45_04431) 4784883..4785065 + 183 WP_003098540.1 type II toxin-antitoxin system HicA family toxin Toxin
PALA45_RS22300 (PALA45_04432) 4785112..4785540 + 429 WP_004351284.1 hypothetical protein Antitoxin
PALA45_RS22305 (PALA45_04433) 4785691..4786065 - 375 WP_004351286.1 antiterminator Q family protein -
PALA45_RS22310 (PALA45_04434) 4786067..4786363 - 297 WP_024082446.1 hypothetical protein -
PALA45_RS22315 (PALA45_04435) 4786360..4786941 - 582 WP_012613699.1 recombination protein NinG -
PALA45_RS22320 (PALA45_04436) 4786938..4787144 - 207 WP_024082445.1 hypothetical protein -
PALA45_RS22325 (PALA45_04437) 4787141..4787938 - 798 WP_012613698.1 hypothetical protein -
PALA45_RS22330 (PALA45_04438) 4787925..4788758 - 834 WP_012613697.1 helix-turn-helix domain-containing protein -
PALA45_RS22335 (PALA45_04439) 4788823..4789527 - 705 WP_012613696.1 phage regulatory protein/antirepressor Ant -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4760077..4803039 42962


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(7-78)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6746.86 Da        Isoelectric Point: 11.0775

>T263683 WP_003098540.1 NZ_CP110351:4784883-4785065 [Pseudomonas aeruginosa]
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGKQTTFADHGAKEMPEPTRKAIIKQLGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 143 a.a.        Molecular weight: 15756.94 Da        Isoelectric Point: 4.6562

>AT263683 WP_004351284.1 NZ_CP110351:4785112-4785540 [Pseudomonas aeruginosa]
MYDYAIRFEQDDSAPGVAVFCRDLPELNSYGDDKVHAIGEAVDAIESTLSLYVDQRREIPAASQAQPGERVIHLPAVTVA
KIALWNEMVRRDMRKADLCRLLGIAQTQGDRLVDFLHNTKMEAMENALSALGLRLSVNIEAA

Download         Length: 429 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References