Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PP_4151-4152/excise(antitoxin)
Location 3428466..3429508 Replicon chromosome
Accession NZ_CP110351
Organism Pseudomonas aeruginosa strain PALA45

Toxin (Protein)


Gene name PP_4152 Uniprot ID -
Locus tag PALA45_RS15685 Protein ID WP_003153636.1
Coordinates 3428466..3429041 (-) Length 192 a.a.

Antitoxin (Protein)


Gene name PP_4151 Uniprot ID I3TV68
Locus tag PALA45_RS15690 Protein ID WP_003050245.1
Coordinates 3429038..3429508 (-) Length 157 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA45_RS15660 (PALA45_03115) 3424904..3425629 - 726 WP_003050273.1 CBASS effector endonuclease NucC -
PALA45_RS15665 (PALA45_03116) 3425668..3426570 - 903 WP_003153640.1 CBASS oligonucleotide cyclase -
PALA45_RS15670 (PALA45_03117) 3426570..3427070 - 501 WP_003090159.1 type III CBASS phage resistance system CD-NTase-associated protein Cap7 -
PALA45_RS15675 (PALA45_03118) 3427067..3427537 - 471 WP_003153638.1 type III CBASS phage resistance system CD-NTase-associated protein Cap8 -
PALA45_RS15680 (PALA45_03119) 3427534..3428448 - 915 WP_003050256.1 AAA family ATPase -
PALA45_RS15685 (PALA45_03120) 3428466..3429041 - 576 WP_003153636.1 PIN domain-containing protein Toxin
PALA45_RS15690 (PALA45_03121) 3429038..3429508 - 471 WP_003050245.1 helix-turn-helix domain-containing protein Antitoxin
PALA45_RS15695 (PALA45_03122) 3429712..3430095 + 384 WP_003090167.1 RAQPRD family integrative conjugative element protein -
PALA45_RS15700 (PALA45_03123) 3430092..3430325 + 234 WP_003050225.1 TIGR03758 family integrating conjugative element protein -
PALA45_RS15705 (PALA45_03124) 3430342..3430701 + 360 WP_003153634.1 TIGR03745 family integrating conjugative element membrane protein -
PALA45_RS15710 (PALA45_03125) 3430714..3431124 + 411 WP_003821108.1 TIGR03750 family conjugal transfer protein -
PALA45_RS15715 (PALA45_03126) 3431121..3431813 + 693 WP_012614071.1 TIGR03746 family integrating conjugative element protein -
PALA45_RS15720 (PALA45_03127) 3431810..3432721 + 912 WP_004350604.1 TIGR03749 family integrating conjugative element protein -
PALA45_RS15725 (PALA45_03128) 3432711..3434129 + 1419 WP_004350605.1 TIGR03752 family integrating conjugative element protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 3378939..3490056 111117


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-114)

Antitoxin

Helix-turn-helix domain, group 17

(85-133)


Sequences

Toxin        


Download         Length: 192 a.a.        Molecular weight: 21629.78 Da        Isoelectric Point: 5.9995

>T263681 WP_003153636.1 NZ_CP110351:c3429041-3428466 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL

Download         Length: 576 bp

Antitoxin


Download         Length: 157 a.a.        Molecular weight: 17245.62 Da        Isoelectric Point: 6.3803

>AT263681 WP_003050245.1 NZ_CP110351:c3429508-3429038 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE

Download         Length: 471 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB I3TV68

References