Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
| Location | 3428466..3429508 | Replicon | chromosome |
| Accession | NZ_CP110351 | ||
| Organism | Pseudomonas aeruginosa strain PALA45 | ||
Toxin (Protein)
| Gene name | PP_4152 | Uniprot ID | - |
| Locus tag | PALA45_RS15685 | Protein ID | WP_003153636.1 |
| Coordinates | 3428466..3429041 (-) | Length | 192 a.a. |
Antitoxin (Protein)
| Gene name | PP_4151 | Uniprot ID | I3TV68 |
| Locus tag | PALA45_RS15690 | Protein ID | WP_003050245.1 |
| Coordinates | 3429038..3429508 (-) | Length | 157 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA45_RS15660 (PALA45_03115) | 3424904..3425629 | - | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
| PALA45_RS15665 (PALA45_03116) | 3425668..3426570 | - | 903 | WP_003153640.1 | CBASS oligonucleotide cyclase | - |
| PALA45_RS15670 (PALA45_03117) | 3426570..3427070 | - | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
| PALA45_RS15675 (PALA45_03118) | 3427067..3427537 | - | 471 | WP_003153638.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
| PALA45_RS15680 (PALA45_03119) | 3427534..3428448 | - | 915 | WP_003050256.1 | AAA family ATPase | - |
| PALA45_RS15685 (PALA45_03120) | 3428466..3429041 | - | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
| PALA45_RS15690 (PALA45_03121) | 3429038..3429508 | - | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PALA45_RS15695 (PALA45_03122) | 3429712..3430095 | + | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
| PALA45_RS15700 (PALA45_03123) | 3430092..3430325 | + | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
| PALA45_RS15705 (PALA45_03124) | 3430342..3430701 | + | 360 | WP_003153634.1 | TIGR03745 family integrating conjugative element membrane protein | - |
| PALA45_RS15710 (PALA45_03125) | 3430714..3431124 | + | 411 | WP_003821108.1 | TIGR03750 family conjugal transfer protein | - |
| PALA45_RS15715 (PALA45_03126) | 3431121..3431813 | + | 693 | WP_012614071.1 | TIGR03746 family integrating conjugative element protein | - |
| PALA45_RS15720 (PALA45_03127) | 3431810..3432721 | + | 912 | WP_004350604.1 | TIGR03749 family integrating conjugative element protein | - |
| PALA45_RS15725 (PALA45_03128) | 3432711..3434129 | + | 1419 | WP_004350605.1 | TIGR03752 family integrating conjugative element protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 3378939..3490056 | 111117 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T263681 WP_003153636.1 NZ_CP110351:c3429041-3428466 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT263681 WP_003050245.1 NZ_CP110351:c3429508-3429038 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|