Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 141945..142450 | Replicon | chromosome |
Accession | NZ_CP110351 | ||
Organism | Pseudomonas aeruginosa strain PALA45 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | PALA45_RS00650 | Protein ID | WP_003083773.1 |
Coordinates | 141945..142226 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | PALA45_RS00655 | Protein ID | WP_003083775.1 |
Coordinates | 142223..142450 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA45_RS00625 (PALA45_00124) | 137196..138545 | + | 1350 | WP_012613447.1 | C4-dicarboxylate transporter DctA | - |
PALA45_RS00630 (PALA45_00125) | 138594..139280 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
PALA45_RS00635 (PALA45_00126) | 139381..140115 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
PALA45_RS00640 (PALA45_00127) | 140295..140705 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
PALA45_RS00645 (PALA45_00128) | 140737..141645 | - | 909 | WP_012613448.1 | LysR family transcriptional regulator | - |
PALA45_RS00650 (PALA45_00129) | 141945..142226 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PALA45_RS00655 (PALA45_00130) | 142223..142450 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PALA45_RS00660 (PALA45_00131) | 142626..143246 | - | 621 | WP_003101226.1 | hypothetical protein | - |
PALA45_RS00665 (PALA45_00132) | 143347..143847 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
PALA45_RS00670 (PALA45_00133) | 143920..144261 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
PALA45_RS00675 (PALA45_00134) | 144343..145770 | - | 1428 | WP_003083784.1 | GABA permease | - |
PALA45_RS00680 (PALA45_00135) | 145939..147432 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T263677 WP_003083773.1 NZ_CP110351:c142226-141945 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|