Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 1251556..1252061 | Replicon | chromosome |
| Accession | NZ_CP110350 | ||
| Organism | Pseudomonas aeruginosa strain PALA44 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | PALA44_RS05775 | Protein ID | WP_003083773.1 |
| Coordinates | 1251556..1251837 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | PALA44_RS05780 | Protein ID | WP_003083775.1 |
| Coordinates | 1251834..1252061 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA44_RS05750 (PALA44_01136) | 1246807..1248156 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
| PALA44_RS05755 (PALA44_01137) | 1248205..1248891 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| PALA44_RS05760 (PALA44_01138) | 1248992..1249726 | + | 735 | WP_003110658.1 | GntR family transcriptional regulator | - |
| PALA44_RS05765 (PALA44_01139) | 1249906..1250316 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
| PALA44_RS05770 (PALA44_01140) | 1250348..1251256 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| PALA44_RS05775 (PALA44_01141) | 1251556..1251837 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| PALA44_RS05780 (PALA44_01142) | 1251834..1252061 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PALA44_RS05785 (PALA44_01143) | 1252237..1252857 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| PALA44_RS05790 (PALA44_01144) | 1252958..1253458 | + | 501 | WP_003162763.1 | LEA type 2 family protein | - |
| PALA44_RS05795 (PALA44_01145) | 1253531..1253872 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| PALA44_RS05800 (PALA44_01146) | 1253954..1255381 | - | 1428 | WP_003083784.1 | GABA permease | - |
| PALA44_RS05805 (PALA44_01147) | 1255550..1257043 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T263672 WP_003083773.1 NZ_CP110350:c1251837-1251556 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|