Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 5795344..5795984 | Replicon | chromosome |
| Accession | NZ_CP110349 | ||
| Organism | Pseudomonas aeruginosa strain PALA40 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PALA40_RS27375 | Protein ID | WP_003134109.1 |
| Coordinates | 5795344..5795754 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PALA40_RS27380 | Protein ID | WP_031634724.1 |
| Coordinates | 5795754..5795984 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA40_RS27335 | 5790870..5791667 | + | 798 | WP_235597565.1 | hypothetical protein | - |
| PALA40_RS27340 (PALA40_05394) | 5791824..5792552 | + | 729 | WP_004352842.1 | TIGR03761 family integrating conjugative element protein | - |
| PALA40_RS27345 (PALA40_05395) | 5792558..5793106 | + | 549 | WP_004352841.1 | DUF3158 family protein | - |
| PALA40_RS27350 (PALA40_05396) | 5793153..5793992 | + | 840 | WP_003105750.1 | Rha family transcriptional regulator | - |
| PALA40_RS27355 (PALA40_05397) | 5794022..5794510 | + | 489 | WP_004352840.1 | single-stranded DNA-binding protein | - |
| PALA40_RS27360 | 5794666..5794833 | + | 168 | WP_128729268.1 | CrpP family ICE-associated protein | - |
| PALA40_RS27365 (PALA40_05398) | 5794899..5795117 | - | 219 | WP_023083218.1 | hypothetical protein | - |
| PALA40_RS27370 (PALA40_05399) | 5795131..5795328 | - | 198 | WP_023083219.1 | hypothetical protein | - |
| PALA40_RS27375 (PALA40_05400) | 5795344..5795754 | - | 411 | WP_003134109.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PALA40_RS27380 | 5795754..5795984 | - | 231 | WP_031634724.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PALA40_RS27385 (PALA40_05401) | 5796240..5798159 | + | 1920 | WP_004352838.1 | type I DNA topoisomerase | - |
| PALA40_RS27390 (PALA40_05402) | 5798467..5798676 | + | 210 | WP_003105733.1 | cold-shock protein | - |
| PALA40_RS27395 (PALA40_05403) | 5798897..5800786 | + | 1890 | WP_003105732.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 5776987..5866552 | 89565 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15452.78 Da Isoelectric Point: 7.3233
>T263669 WP_003134109.1 NZ_CP110349:c5795754-5795344 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|