Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 5795344..5795984 Replicon chromosome
Accession NZ_CP110349
Organism Pseudomonas aeruginosa strain PALA40

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag PALA40_RS27375 Protein ID WP_003134109.1
Coordinates 5795344..5795754 (-) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag PALA40_RS27380 Protein ID WP_031634724.1
Coordinates 5795754..5795984 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA40_RS27335 5790870..5791667 + 798 WP_235597565.1 hypothetical protein -
PALA40_RS27340 (PALA40_05394) 5791824..5792552 + 729 WP_004352842.1 TIGR03761 family integrating conjugative element protein -
PALA40_RS27345 (PALA40_05395) 5792558..5793106 + 549 WP_004352841.1 DUF3158 family protein -
PALA40_RS27350 (PALA40_05396) 5793153..5793992 + 840 WP_003105750.1 Rha family transcriptional regulator -
PALA40_RS27355 (PALA40_05397) 5794022..5794510 + 489 WP_004352840.1 single-stranded DNA-binding protein -
PALA40_RS27360 5794666..5794833 + 168 WP_128729268.1 CrpP family ICE-associated protein -
PALA40_RS27365 (PALA40_05398) 5794899..5795117 - 219 WP_023083218.1 hypothetical protein -
PALA40_RS27370 (PALA40_05399) 5795131..5795328 - 198 WP_023083219.1 hypothetical protein -
PALA40_RS27375 (PALA40_05400) 5795344..5795754 - 411 WP_003134109.1 tRNA(fMet)-specific endonuclease VapC Toxin
PALA40_RS27380 5795754..5795984 - 231 WP_031634724.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PALA40_RS27385 (PALA40_05401) 5796240..5798159 + 1920 WP_004352838.1 type I DNA topoisomerase -
PALA40_RS27390 (PALA40_05402) 5798467..5798676 + 210 WP_003105733.1 cold-shock protein -
PALA40_RS27395 (PALA40_05403) 5798897..5800786 + 1890 WP_003105732.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 5776987..5866552 89565


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin

SpoVT-AbrB domain

(7-33)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 15452.78 Da        Isoelectric Point: 7.3233

>T263669 WP_003134109.1 NZ_CP110349:c5795754-5795344 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8420.29 Da        Isoelectric Point: 4.2821

>AT263669 WP_031634724.1 NZ_CP110349:c5795984-5795754 [Pseudomonas aeruginosa]
VEQGSVFQSNRSQAVRLPKAVALPDDVKRVDVVAVGRARIITPAGESWDSWFDGEGVTADFMAEREQPADQERETF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References