Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
| Location | 3000028..3001070 | Replicon | chromosome |
| Accession | NZ_CP110349 | ||
| Organism | Pseudomonas aeruginosa strain PALA40 | ||
Toxin (Protein)
| Gene name | PP_4152 | Uniprot ID | - |
| Locus tag | PALA40_RS14385 | Protein ID | WP_003153636.1 |
| Coordinates | 3000495..3001070 (+) | Length | 192 a.a. |
Antitoxin (Protein)
| Gene name | PP_4151 | Uniprot ID | I3TV68 |
| Locus tag | PALA40_RS14380 | Protein ID | WP_003050245.1 |
| Coordinates | 3000028..3000498 (+) | Length | 157 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA40_RS14345 (PALA40_02843) | 2995420..2996838 | - | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
| PALA40_RS14350 (PALA40_02844) | 2996828..2997739 | - | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
| PALA40_RS14355 (PALA40_02845) | 2997736..2998428 | - | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
| PALA40_RS14360 (PALA40_02846) | 2998425..2998823 | - | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
| PALA40_RS14365 (PALA40_02847) | 2998835..2999194 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
| PALA40_RS14370 (PALA40_02848) | 2999211..2999444 | - | 234 | WP_006226027.1 | TIGR03758 family integrating conjugative element protein | - |
| PALA40_RS14375 (PALA40_02849) | 2999441..2999824 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
| PALA40_RS14380 (PALA40_02850) | 3000028..3000498 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PALA40_RS14385 (PALA40_02851) | 3000495..3001070 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
| PALA40_RS14390 (PALA40_02852) | 3001088..3002002 | + | 915 | WP_016852809.1 | AAA family ATPase | - |
| PALA40_RS14395 (PALA40_02853) | 3001999..3002469 | + | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
| PALA40_RS14400 (PALA40_02854) | 3002466..3002966 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
| PALA40_RS14405 (PALA40_02855) | 3002966..3003868 | + | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
| PALA40_RS14410 (PALA40_02856) | 3003907..3004632 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2925453..3047186 | 121733 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T263666 WP_003153636.1 NZ_CP110349:3000495-3001070 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT263666 WP_003050245.1 NZ_CP110349:3000028-3000498 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|