Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 155181..155686 | Replicon | chromosome |
| Accession | NZ_CP110348 | ||
| Organism | Pseudomonas aeruginosa strain PALA36 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | PALA36_RS00725 | Protein ID | WP_003083773.1 |
| Coordinates | 155181..155462 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | PALA36_RS00730 | Protein ID | WP_003083775.1 |
| Coordinates | 155459..155686 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA36_RS00700 (PALA36_00137) | 150432..151781 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
| PALA36_RS00705 (PALA36_00138) | 151830..152516 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| PALA36_RS00710 (PALA36_00139) | 152617..153351 | + | 735 | WP_003110658.1 | GntR family transcriptional regulator | - |
| PALA36_RS00715 (PALA36_00140) | 153531..153941 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
| PALA36_RS00720 (PALA36_00141) | 153973..154881 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| PALA36_RS00725 (PALA36_00142) | 155181..155462 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| PALA36_RS00730 (PALA36_00143) | 155459..155686 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PALA36_RS00735 (PALA36_00144) | 155862..156482 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| PALA36_RS00740 (PALA36_00145) | 156583..157083 | + | 501 | WP_003162763.1 | LEA type 2 family protein | - |
| PALA36_RS00745 (PALA36_00146) | 157156..157497 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| PALA36_RS00750 (PALA36_00147) | 157579..159006 | - | 1428 | WP_003083784.1 | GABA permease | - |
| PALA36_RS00755 (PALA36_00148) | 159175..160668 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T263657 WP_003083773.1 NZ_CP110348:c155462-155181 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|