Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 141837..142342 | Replicon | chromosome |
Accession | NZ_CP110347 | ||
Organism | Pseudomonas aeruginosa strain PALA52 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | PALA52_RS00655 | Protein ID | WP_263957364.1 |
Coordinates | 141837..142118 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | PALA52_RS00660 | Protein ID | WP_003083775.1 |
Coordinates | 142115..142342 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA52_RS00630 (PALA52_00121) | 137083..138432 | + | 1350 | WP_079752987.1 | C4-dicarboxylate transporter DctA | - |
PALA52_RS00635 (PALA52_00122) | 138481..139167 | + | 687 | WP_024916687.1 | FadR/GntR family transcriptional regulator | - |
PALA52_RS00640 (PALA52_00123) | 139269..140003 | + | 735 | WP_024916686.1 | GntR family transcriptional regulator | - |
PALA52_RS00645 (PALA52_00124) | 140183..140593 | + | 411 | WP_024916685.1 | aegerolysin family protein | - |
PALA52_RS00650 (PALA52_00125) | 140628..141536 | - | 909 | WP_263957365.1 | LysR family transcriptional regulator | - |
PALA52_RS00655 (PALA52_00126) | 141837..142118 | - | 282 | WP_263957364.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PALA52_RS00660 (PALA52_00127) | 142115..142342 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PALA52_RS00665 (PALA52_00128) | 142518..143138 | - | 621 | WP_263957363.1 | hypothetical protein | - |
PALA52_RS00670 (PALA52_00129) | 143239..143739 | + | 501 | WP_024916682.1 | LEA type 2 family protein | - |
PALA52_RS00675 (PALA52_00130) | 143812..144153 | + | 342 | WP_024916681.1 | zinc ribbon domain-containing protein YjdM | - |
PALA52_RS00680 (PALA52_00131) | 144273..145700 | - | 1428 | WP_270125000.1 | GABA permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10445.21 Da Isoelectric Point: 9.6558
>T263652 WP_263957364.1 NZ_CP110347:c142118-141837 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQEVANQGAGRPSEVPGVRTLALERWPFSAPFRVKGKE
IQILRIDRVEIIP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQEVANQGAGRPSEVPGVRTLALERWPFSAPFRVKGKE
IQILRIDRVEIIP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|