Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5119046..5119654 | Replicon | chromosome |
Accession | NZ_CP110346 | ||
Organism | Pseudomonas aeruginosa strain PALA35 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A444LUU5 |
Locus tag | PALA35_RS23895 | Protein ID | WP_019486378.1 |
Coordinates | 5119046..5119393 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | PALA35_RS23900 | Protein ID | WP_003114155.1 |
Coordinates | 5119403..5119654 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA35_RS23865 (PALA35_04721) | 5114405..5114677 | + | 273 | WP_021264275.1 | cysteine-rich CWC family protein | - |
PALA35_RS23870 (PALA35_04722) | 5114677..5115369 | + | 693 | WP_022579823.1 | 16S rRNA pseudouridine(516) synthase | - |
PALA35_RS23875 (PALA35_04723) | 5115505..5116548 | + | 1044 | WP_003134392.1 | L,D-transpeptidase | - |
PALA35_RS23880 (PALA35_04724) | 5116628..5117365 | + | 738 | WP_003085453.1 | murein L,D-transpeptidase catalytic domain family protein | - |
PALA35_RS23885 (PALA35_04725) | 5117817..5118719 | + | 903 | WP_003085447.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
PALA35_RS23895 (PALA35_04727) | 5119046..5119393 | - | 348 | WP_019486378.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA35_RS23900 | 5119403..5119654 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PALA35_RS23905 (PALA35_04728) | 5119868..5120851 | - | 984 | WP_096225069.1 | tyrosine-type recombinase/integrase | - |
PALA35_RS23910 (PALA35_04729) | 5120851..5122143 | - | 1293 | WP_003123045.1 | hypothetical protein | - |
PALA35_RS23915 (PALA35_04731) | 5122373..5123647 | - | 1275 | WP_269974439.1 | zonular occludens toxin family protein | - |
PALA35_RS23920 (PALA35_04732) | 5123651..5124007 | - | 357 | WP_269974440.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 5119046..5133015 | 13969 | |
- | inside | Prophage | - | - | 5109962..5133015 | 23053 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12956.72 Da Isoelectric Point: 4.4212
>T263650 WP_019486378.1 NZ_CP110346:c5119393-5119046 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A444LUU5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |