Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 141772..142277 | Replicon | chromosome |
Accession | NZ_CP110346 | ||
Organism | Pseudomonas aeruginosa strain PALA35 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | PALA35_RS00655 | Protein ID | WP_003083773.1 |
Coordinates | 141772..142053 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A0H2ZJU8 |
Locus tag | PALA35_RS00660 | Protein ID | WP_003137009.1 |
Coordinates | 142050..142277 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA35_RS00630 (PALA35_00126) | 137023..138372 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
PALA35_RS00635 (PALA35_00127) | 138421..139101 | + | 681 | WP_043084877.1 | FadR/GntR family transcriptional regulator | - |
PALA35_RS00640 (PALA35_00128) | 139208..139942 | + | 735 | WP_023107524.1 | GntR family transcriptional regulator | - |
PALA35_RS00645 (PALA35_00129) | 140122..140532 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
PALA35_RS00650 (PALA35_00130) | 140564..141472 | - | 909 | WP_269974638.1 | LysR family transcriptional regulator | - |
PALA35_RS00655 (PALA35_00131) | 141772..142053 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PALA35_RS00660 (PALA35_00132) | 142050..142277 | - | 228 | WP_003137009.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PALA35_RS00665 (PALA35_00133) | 142453..143073 | - | 621 | WP_269974639.1 | hypothetical protein | - |
PALA35_RS00670 (PALA35_00134) | 143174..143674 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
PALA35_RS00675 (PALA35_00135) | 143747..144088 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
PALA35_RS00680 (PALA35_00136) | 144173..145600 | - | 1428 | WP_023092260.1 | GABA permease | - |
PALA35_RS00685 (PALA35_00137) | 145769..147262 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T263643 WP_003083773.1 NZ_CP110346:c142053-141772 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|