Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2860956..2861998 | Replicon | chromosome |
Accession | NZ_CP110345 | ||
Organism | Pseudomonas aeruginosa strain PALA30 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PALA30_RS13750 | Protein ID | WP_003153636.1 |
Coordinates | 2861423..2861998 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PALA30_RS13745 | Protein ID | WP_003050245.1 |
Coordinates | 2860956..2861426 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA30_RS13710 (PALA30_02709) | 2856348..2857766 | - | 1419 | WP_023100422.1 | TIGR03752 family integrating conjugative element protein | - |
PALA30_RS13715 (PALA30_02710) | 2857756..2858667 | - | 912 | WP_023100423.1 | TIGR03749 family integrating conjugative element protein | - |
PALA30_RS13720 (PALA30_02711) | 2858664..2859356 | - | 693 | WP_023100424.1 | TIGR03746 family integrating conjugative element protein | - |
PALA30_RS13725 (PALA30_02712) | 2859353..2859751 | - | 399 | WP_003105639.1 | TIGR03750 family conjugal transfer protein | - |
PALA30_RS13730 (PALA30_02713) | 2859763..2860122 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PALA30_RS13735 (PALA30_02714) | 2860139..2860372 | - | 234 | WP_003090170.1 | TIGR03758 family integrating conjugative element protein | - |
PALA30_RS13740 (PALA30_02715) | 2860369..2860752 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
PALA30_RS13745 (PALA30_02716) | 2860956..2861426 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PALA30_RS13750 (PALA30_02717) | 2861423..2861998 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
PALA30_RS13755 (PALA30_02718) | 2862016..2862930 | + | 915 | WP_016852809.1 | AAA family ATPase | - |
PALA30_RS13760 (PALA30_02719) | 2862927..2863397 | + | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PALA30_RS13765 (PALA30_02720) | 2863394..2863894 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PALA30_RS13770 (PALA30_02721) | 2863894..2864796 | + | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
PALA30_RS13775 (PALA30_02722) | 2864835..2865560 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2775080..2910396 | 135316 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T263638 WP_003153636.1 NZ_CP110345:2861423-2861998 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT263638 WP_003050245.1 NZ_CP110345:2860956-2861426 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|