Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-StbC
Location 1344602..1345272 Replicon chromosome
Accession NZ_CP110345
Organism Pseudomonas aeruginosa strain PALA30

Toxin (Protein)


Gene name vapC Uniprot ID A0A6M2XLD2
Locus tag PALA30_RS06300 Protein ID WP_005934647.1
Coordinates 1344853..1345272 (+) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag PALA30_RS06295 Protein ID WP_023114648.1
Coordinates 1344602..1344856 (+) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA30_RS06275 (PALA30_01245) 1340542..1341543 - 1002 WP_058176106.1 hypothetical protein -
PALA30_RS06280 (PALA30_01246) 1341629..1341853 + 225 WP_009363662.1 AlpA family phage regulatory protein -
PALA30_RS06285 (PALA30_01247) 1341856..1342734 + 879 WP_058176105.1 helicase RepA family protein -
PALA30_RS06290 (PALA30_01248) 1342721..1343473 + 753 WP_058176104.1 hypothetical protein -
PALA30_RS06295 (PALA30_01249) 1344602..1344856 + 255 WP_023114648.1 Arc family DNA-binding protein Antitoxin
PALA30_RS06300 (PALA30_01250) 1344853..1345272 + 420 WP_005934647.1 type II toxin-antitoxin system VapC family toxin Toxin
PALA30_RS06305 (PALA30_01251) 1345429..1346199 + 771 WP_058176103.1 P-type conjugative transfer protein TrbJ -
PALA30_RS06310 (PALA30_01252) 1346210..1346368 + 159 WP_156797749.1 hypothetical protein -
PALA30_RS06315 (PALA30_01253) 1346370..1347839 + 1470 WP_058176102.1 P-type conjugative transfer protein TrbL -
PALA30_RS06320 (PALA30_01254) 1347908..1348150 + 243 WP_003137888.1 type I toxin-antitoxin system ptaRNA1 family toxin -
PALA30_RS06325 (PALA30_01255) 1348162..1348443 + 282 WP_058176101.1 hypothetical protein -
PALA30_RS06330 (PALA30_01256) 1348446..1348814 + 369 WP_058176100.1 conjugal transfer transcriptional regulator TraJ -
PALA30_RS06335 1348852..1349082 - 231 WP_235582614.1 hypothetical protein -
PALA30_RS06340 1349062..1349310 - 249 Protein_1255 XRE family transcriptional regulator -
PALA30_RS06345 (PALA30_01258) 1349307..1349483 - 177 WP_096222004.1 transcriptional regulator -
PALA30_RS06350 (PALA30_01259) 1349658..1350245 + 588 Protein_1257 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1340542..1350887 10345


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-123)

Antitoxin

Arc-like DNA binding domain

(9-46)


Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14897.11 Da        Isoelectric Point: 5.1890

>T263635 WP_005934647.1 NZ_CP110345:1344853-1345272 [Pseudomonas aeruginosa]
MIVLDTNVVSEAMKPEPNPAVRAWLNEQVAETLYLSSVTLAELLFGIGALPNGKRKKGLGEALDGLLELFGERVLMFDTE
AARHYAELAVKARTAGKGFPTPDGYIGAIAASKGFIVATRDTSPFEAAGLTVINPWNHQ

Download         Length: 420 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9508.87 Da        Isoelectric Point: 6.4760

>AT263635 WP_023114648.1 NZ_CP110345:1344602-1344856 [Pseudomonas aeruginosa]
MAILTVRNVPDEVHRALRLRAAEHGRSTEAEVREILESAVKSEKRIRMGDALAELGRRVGLTNDDFAVLDQVRDKVPAEP
MRFE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6M2XLD2

Antitoxin

Source ID Structure

References