Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 3089247..3089833 | Replicon | chromosome |
Accession | NZ_CP110344 | ||
Organism | Pseudomonas aeruginosa strain PALA24 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | PALA24_RS14840 | Protein ID | WP_003120987.1 |
Coordinates | 3089247..3089546 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PALA24_RS14845 | Protein ID | WP_003448662.1 |
Coordinates | 3089543..3089833 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA24_RS14820 (PALA24_02949) | 3084363..3084896 | - | 534 | WP_003120993.1 | type IV pilus biogenesis protein PilP | - |
PALA24_RS14825 (PALA24_02950) | 3084886..3086211 | - | 1326 | WP_003120992.1 | type 4b pilus protein PilO2 | - |
PALA24_RS14830 (PALA24_02951) | 3086215..3087924 | - | 1710 | WP_010792227.1 | PilN family type IVB pilus formation outer membrane protein | - |
PALA24_RS14835 (PALA24_02952) | 3087924..3089045 | - | 1122 | WP_003448658.1 | TcpQ domain-containing protein | - |
PALA24_RS14840 (PALA24_02953) | 3089247..3089546 | + | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA24_RS14845 (PALA24_02954) | 3089543..3089833 | + | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
PALA24_RS14850 | 3089904..3090248 | - | 345 | WP_003448665.1 | hypothetical protein | - |
PALA24_RS14855 | 3090245..3090379 | - | 135 | WP_033179080.1 | hypothetical protein | - |
PALA24_RS14860 (PALA24_02955) | 3090389..3092365 | - | 1977 | WP_010792226.1 | DEAD/DEAH box helicase | - |
PALA24_RS14865 (PALA24_02956) | 3092362..3094251 | - | 1890 | WP_003448700.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 3029642..3118781 | 89139 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T263631 WP_003120987.1 NZ_CP110344:3089247-3089546 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|