Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PP_4151-4152/excise(antitoxin)
Location 2433974..2435016 Replicon chromosome
Accession NZ_CP110344
Organism Pseudomonas aeruginosa strain PALA24

Toxin (Protein)


Gene name PP_4152 Uniprot ID -
Locus tag PALA24_RS11470 Protein ID WP_003109777.1
Coordinates 2434441..2435016 (+) Length 192 a.a.

Antitoxin (Protein)


Gene name PP_4151 Uniprot ID I3TV68
Locus tag PALA24_RS11465 Protein ID WP_003050245.1
Coordinates 2433974..2434444 (+) Length 157 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA24_RS11430 (PALA24_02272) 2429366..2430784 - 1419 WP_003119999.1 TIGR03752 family integrating conjugative element protein -
PALA24_RS11435 (PALA24_02273) 2430774..2431685 - 912 WP_010791730.1 TIGR03749 family integrating conjugative element protein -
PALA24_RS11440 (PALA24_02274) 2431682..2432374 - 693 WP_003090182.1 TIGR03746 family integrating conjugative element protein -
PALA24_RS11445 (PALA24_02275) 2432371..2432769 - 399 WP_003050133.1 TIGR03750 family conjugal transfer protein -
PALA24_RS11450 (PALA24_02276) 2432781..2433140 - 360 WP_003090173.1 TIGR03745 family integrating conjugative element membrane protein -
PALA24_RS11455 (PALA24_02277) 2433157..2433390 - 234 WP_003090170.1 TIGR03758 family integrating conjugative element protein -
PALA24_RS11460 (PALA24_02278) 2433387..2433770 - 384 WP_003120001.1 RAQPRD family integrative conjugative element protein -
PALA24_RS11465 (PALA24_02279) 2433974..2434444 + 471 WP_003050245.1 helix-turn-helix domain-containing protein Antitoxin
PALA24_RS11470 (PALA24_02280) 2434441..2435016 + 576 WP_003109777.1 PIN domain-containing protein Toxin
PALA24_RS11475 (PALA24_02281) 2435034..2435948 + 915 WP_003120002.1 AAA family ATPase -
PALA24_RS11480 (PALA24_02282) 2435945..2436415 + 471 WP_003105626.1 type III CBASS phage resistance system CD-NTase-associated protein Cap8 -
PALA24_RS11485 (PALA24_02283) 2436412..2436912 + 501 WP_003090159.1 type III CBASS phage resistance system CD-NTase-associated protein Cap7 -
PALA24_RS11490 (PALA24_02284) 2436912..2437814 + 903 WP_003105624.1 CBASS oligonucleotide cyclase -
PALA24_RS11495 (PALA24_02285) 2437853..2438578 + 726 WP_003120003.1 CBASS effector endonuclease NucC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2341103..2478913 137810


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-114)

Antitoxin

Helix-turn-helix domain, group 17

(85-133)


Sequences

Toxin        


Download         Length: 192 a.a.        Molecular weight: 21644.79 Da        Isoelectric Point: 5.6172

>T263628 WP_003109777.1 NZ_CP110344:2434441-2435016 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL

Download         Length: 576 bp

Antitoxin


Download         Length: 157 a.a.        Molecular weight: 17245.62 Da        Isoelectric Point: 6.3803

>AT263628 WP_003050245.1 NZ_CP110344:2433974-2434444 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE

Download         Length: 471 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB I3TV68

References