Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 150454..150959 | Replicon | chromosome |
Accession | NZ_CP110344 | ||
Organism | Pseudomonas aeruginosa strain PALA24 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | PALA24_RS00685 | Protein ID | WP_003083773.1 |
Coordinates | 150454..150735 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | PALA24_RS00690 | Protein ID | WP_003083775.1 |
Coordinates | 150732..150959 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA24_RS00660 (PALA24_00129) | 145705..147054 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
PALA24_RS00665 (PALA24_00130) | 147103..147789 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
PALA24_RS00670 (PALA24_00131) | 147890..148624 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
PALA24_RS00675 (PALA24_00132) | 148804..149214 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
PALA24_RS00680 (PALA24_00133) | 149246..150154 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
PALA24_RS00685 (PALA24_00134) | 150454..150735 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PALA24_RS00690 (PALA24_00135) | 150732..150959 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PALA24_RS00695 (PALA24_00136) | 151135..151755 | - | 621 | WP_003101226.1 | hypothetical protein | - |
PALA24_RS00700 (PALA24_00137) | 151856..152356 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
PALA24_RS00705 (PALA24_00138) | 152429..152770 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
PALA24_RS00710 (PALA24_00139) | 152852..154279 | - | 1428 | WP_003083784.1 | GABA permease | - |
PALA24_RS00715 (PALA24_00140) | 154448..155941 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T263626 WP_003083773.1 NZ_CP110344:c150735-150454 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|