Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 4087479..4088026 | Replicon | chromosome |
| Accession | NZ_CP110342 | ||
| Organism | Marinobacter sp. AN1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | LJ360_RS18820 | Protein ID | WP_091853961.1 |
| Coordinates | 4087724..4088026 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | LJ360_RS18815 | Protein ID | WP_091853963.1 |
| Coordinates | 4087479..4087736 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LJ360_RS18770 (LJ360_18770) | 4082552..4083307 | - | 756 | WP_264994736.1 | IS21-like element helper ATPase IstB | - |
| LJ360_RS18775 (LJ360_18775) | 4083322..4084866 | - | 1545 | WP_264994737.1 | IS21 family transposase | - |
| LJ360_RS18780 (LJ360_18780) | 4085023..4085271 | + | 249 | WP_264994738.1 | hypothetical protein | - |
| LJ360_RS18785 (LJ360_18785) | 4085331..4085648 | - | 318 | WP_264994739.1 | CcdB family protein | - |
| LJ360_RS18790 (LJ360_18790) | 4085648..4085893 | - | 246 | WP_091853970.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
| LJ360_RS18795 (LJ360_18795) | 4086082..4086393 | + | 312 | WP_091853968.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LJ360_RS18800 (LJ360_18800) | 4086386..4086673 | + | 288 | WP_012137897.1 | type II toxin-antitoxin system MqsA family antitoxin | - |
| LJ360_RS18805 (LJ360_18805) | 4086834..4087076 | + | 243 | WP_058092928.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| LJ360_RS18810 (LJ360_18810) | 4087073..4087336 | + | 264 | WP_091853965.1 | Txe/YoeB family addiction module toxin | - |
| LJ360_RS18815 (LJ360_18815) | 4087479..4087736 | + | 258 | WP_091853963.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| LJ360_RS18820 (LJ360_18820) | 4087724..4088026 | + | 303 | WP_091853961.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LJ360_RS18825 (LJ360_18825) | 4088175..4088399 | + | 225 | WP_091853959.1 | addiction module protein | - |
| LJ360_RS18830 (LJ360_18830) | 4088396..4088689 | + | 294 | WP_091853957.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LJ360_RS18835 (LJ360_18835) | 4088791..4089189 | + | 399 | WP_264994740.1 | VOC family protein | - |
| LJ360_RS18840 (LJ360_18840) | 4089343..4089744 | + | 402 | WP_264994741.1 | GFA family protein | - |
| LJ360_RS18845 (LJ360_18845) | 4089805..4090251 | - | 447 | WP_177186078.1 | DUF4124 domain-containing protein | - |
| LJ360_RS18850 (LJ360_18850) | 4090376..4091407 | + | 1032 | WP_091853951.1 | DUF2157 domain-containing protein | - |
| LJ360_RS18855 (LJ360_18855) | 4091494..4092759 | + | 1266 | WP_091853949.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11650.32 Da Isoelectric Point: 4.3535
>T263625 WP_091853961.1 NZ_CP110342:4087724-4088026 [Marinobacter sp. AN1]
MAEVIWTEPALQELDAIAEYIALDNPAAASHLVQEVFDKTERLEDFPQSGRIPPELPNSVYREIVVPPCRIFYREDDKRV
LILYVMREERQLRAYMLGNS
MAEVIWTEPALQELDAIAEYIALDNPAAASHLVQEVFDKTERLEDFPQSGRIPPELPNSVYREIVVPPCRIFYREDDKRV
LILYVMREERQLRAYMLGNS
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|