Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 4187096..4187769 | Replicon | chromosome |
| Accession | NZ_CP110339 | ||
| Organism | Brucella sp. JSBI001 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | LJ361_RS20010 | Protein ID | WP_264812156.1 |
| Coordinates | 4187096..4187518 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | LJ361_RS20015 | Protein ID | WP_264813611.1 |
| Coordinates | 4187515..4187769 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LJ361_RS19965 (LJ361_19965) | 4182236..4182505 | - | 270 | WP_264812146.1 | helix-turn-helix domain-containing protein | - |
| LJ361_RS19970 (LJ361_19970) | 4182996..4183283 | + | 288 | WP_264812147.1 | DUF2285 domain-containing protein | - |
| LJ361_RS19975 (LJ361_19975) | 4183356..4183670 | + | 315 | WP_264812148.1 | DUF6506 family protein | - |
| LJ361_RS19980 (LJ361_19980) | 4183728..4184249 | - | 522 | WP_264813610.1 | DUF2285 domain-containing protein | - |
| LJ361_RS19985 (LJ361_19985) | 4184296..4184511 | - | 216 | WP_264812149.1 | DUF6499 domain-containing protein | - |
| LJ361_RS19990 (LJ361_19990) | 4184637..4184819 | - | 183 | WP_264812151.1 | hypothetical protein | - |
| LJ361_RS19995 (LJ361_19995) | 4184822..4185661 | - | 840 | WP_264812152.1 | DUF932 domain-containing protein | - |
| LJ361_RS20000 (LJ361_20000) | 4186010..4186327 | - | 318 | WP_264812153.1 | DUF736 domain-containing protein | - |
| LJ361_RS20005 (LJ361_20005) | 4186603..4186857 | + | 255 | WP_264812155.1 | hypothetical protein | - |
| LJ361_RS20010 (LJ361_20010) | 4187096..4187518 | - | 423 | WP_264812156.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LJ361_RS20015 (LJ361_20015) | 4187515..4187769 | - | 255 | WP_264813611.1 | plasmid stabilization protein | Antitoxin |
| LJ361_RS20020 (LJ361_20020) | 4187862..4188566 | - | 705 | WP_264812158.1 | hypothetical protein | - |
| LJ361_RS20025 (LJ361_20025) | 4188473..4188889 | - | 417 | WP_264812161.1 | hypothetical protein | - |
| LJ361_RS20030 (LJ361_20030) | 4189104..4191180 | - | 2077 | Protein_3951 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4159869..4202253 | 42384 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 14851.90 Da Isoelectric Point: 4.6556
>T263620 WP_264812156.1 NZ_CP110339:c4187518-4187096 [Brucella sp. JSBI001]
MILLDTNVVSEAMKPEQAPAVRDWLDEQAAETLYLSSVTVAELLFGIGAMPDGRRKQRLATTLDGLLPLFEGRILPFDTN
AARHYADLAVAARKAGKGFPTPDGYIAAIAADQGFAVATRDASAFNAAGVPVIDPWTAGH
MILLDTNVVSEAMKPEQAPAVRDWLDEQAAETLYLSSVTVAELLFGIGAMPDGRRKQRLATTLDGLLPLFEGRILPFDTN
AARHYADLAVAARKAGKGFPTPDGYIAAIAADQGFAVATRDASAFNAAGVPVIDPWTAGH
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|