Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_26 |
Location | 3916664..3917301 | Replicon | chromosome |
Accession | NZ_CP110339 | ||
Organism | Brucella sp. JSBI001 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | LJ361_RS18625 | Protein ID | WP_151657858.1 |
Coordinates | 3916664..3916918 (+) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | LJ361_RS18630 | Protein ID | WP_151657857.1 |
Coordinates | 3916930..3917301 (+) | Length | 124 a.a. |
Genomic Context
Location: 3912018..3912308 (291 bp)
Type: Others
Protein ID: WP_063882078.1
Type: Others
Protein ID: WP_063882078.1
Location: 3912301..3912861 (561 bp)
Type: Others
Protein ID: WP_063882077.1
Type: Others
Protein ID: WP_063882077.1
Location: 3912863..3913159 (297 bp)
Type: Others
Protein ID: WP_151657862.1
Type: Others
Protein ID: WP_151657862.1
Location: 3913175..3915391 (2217 bp)
Type: Others
Protein ID: WP_151657861.1
Type: Others
Protein ID: WP_151657861.1
Location: 3915388..3915804 (417 bp)
Type: Others
Protein ID: WP_151657860.1
Type: Others
Protein ID: WP_151657860.1
Location: 3916080..3916643 (564 bp)
Type: Others
Protein ID: WP_151657859.1
Type: Others
Protein ID: WP_151657859.1
Location: 3916664..3916918 (255 bp)
Type: Toxin
Protein ID: WP_151657858.1
Type: Toxin
Protein ID: WP_151657858.1
Location: 3916930..3917301 (372 bp)
Type: Antitoxin
Protein ID: WP_151657857.1
Type: Antitoxin
Protein ID: WP_151657857.1
Location: 3917314..3917892 (579 bp)
Type: Others
Protein ID: WP_151657856.1
Type: Others
Protein ID: WP_151657856.1
Location: 3917933..3918613 (681 bp)
Type: Others
Protein ID: WP_151657855.1
Type: Others
Protein ID: WP_151657855.1
Location: 3918657..3918872 (216 bp)
Type: Others
Protein ID: WP_151657854.1
Type: Others
Protein ID: WP_151657854.1
Location: 3918990..3919355 (366 bp)
Type: Others
Protein ID: WP_151657853.1
Type: Others
Protein ID: WP_151657853.1
Location: 3919760..3919951 (192 bp)
Type: Others
Protein ID: WP_151657851.1
Type: Others
Protein ID: WP_151657851.1
Location: 3920090..3920332 (243 bp)
Type: Others
Protein ID: WP_151657850.1
Type: Others
Protein ID: WP_151657850.1
Location: 3920325..3920780 (456 bp)
Type: Others
Protein ID: WP_151657849.1
Type: Others
Protein ID: WP_151657849.1
Location: 3920791..3921468 (678 bp)
Type: Others
Protein ID: WP_264812082.1
Type: Others
Protein ID: WP_264812082.1
Location: 3921468..3921821 (354 bp)
Type: Others
Protein ID: WP_151657847.1
Type: Others
Protein ID: WP_151657847.1
Location: 3921818..3922204 (387 bp)
Type: Others
Protein ID: WP_151657846.1
Type: Others
Protein ID: WP_151657846.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LJ361_RS18595 (LJ361_18595) | 3912018..3912308 | + | 291 | WP_063882078.1 | hypothetical protein | - |
LJ361_RS18600 (LJ361_18600) | 3912301..3912861 | + | 561 | WP_063882077.1 | hypothetical protein | - |
LJ361_RS18605 (LJ361_18605) | 3912863..3913159 | + | 297 | WP_151657862.1 | hypothetical protein | - |
LJ361_RS18610 (LJ361_18610) | 3913175..3915391 | + | 2217 | WP_151657861.1 | AAA family ATPase | - |
LJ361_RS18615 (LJ361_18615) | 3915388..3915804 | + | 417 | WP_151657860.1 | hypothetical protein | - |
LJ361_RS18620 (LJ361_18620) | 3916080..3916643 | + | 564 | WP_151657859.1 | hypothetical protein | - |
LJ361_RS18625 (LJ361_18625) | 3916664..3916918 | + | 255 | WP_151657858.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LJ361_RS18630 (LJ361_18630) | 3916930..3917301 | + | 372 | WP_151657857.1 | helix-turn-helix transcriptional regulator | Antitoxin |
LJ361_RS18635 (LJ361_18635) | 3917314..3917892 | + | 579 | WP_151657856.1 | hypothetical protein | - |
LJ361_RS18640 (LJ361_18640) | 3917933..3918613 | + | 681 | WP_151657855.1 | SOS response-associated peptidase | - |
LJ361_RS18645 (LJ361_18645) | 3918657..3918872 | + | 216 | WP_151657854.1 | hypothetical protein | - |
LJ361_RS18650 (LJ361_18650) | 3918990..3919355 | - | 366 | WP_151657853.1 | thermonuclease family protein | - |
LJ361_RS18655 (LJ361_18655) | 3919760..3919951 | - | 192 | WP_151657851.1 | hypothetical protein | - |
LJ361_RS18660 (LJ361_18660) | 3920090..3920332 | - | 243 | WP_151657850.1 | HTH domain-containing protein | - |
LJ361_RS18665 (LJ361_18665) | 3920325..3920780 | - | 456 | WP_151657849.1 | hypothetical protein | - |
LJ361_RS18670 (LJ361_18670) | 3920791..3921468 | - | 678 | WP_264812082.1 | hypothetical protein | - |
LJ361_RS18675 (LJ361_18675) | 3921468..3921821 | - | 354 | WP_151657847.1 | hypothetical protein | - |
LJ361_RS18680 (LJ361_18680) | 3921818..3922204 | - | 387 | WP_151657846.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3899608..3950822 | 51214 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9344.85 Da Isoelectric Point: 10.2211
>T263619 WP_151657858.1 NZ_CP110339:3916664-3916918 [Brucella sp. JSBI001]
MEQITYSREATKTLIKMPANTAKLIRSKIEQYAADPASLANNVKALKGGEGLLRLRVGDWRVIFTEDGRIIEVIRIAPRG
GAYE
MEQITYSREATKTLIKMPANTAKLIRSKIEQYAADPASLANNVKALKGGEGLLRLRVGDWRVIFTEDGRIIEVIRIAPRG
GAYE
Download Length: 255 bp
Antitoxin
Download Length: 124 a.a. Molecular weight: 13532.54 Da Isoelectric Point: 4.4987
>AT263619 WP_151657857.1 NZ_CP110339:3916930-3917301 [Brucella sp. JSBI001]
MNVQIIKTPQGEEMAVLPKADYDKLLEAFEDREDIAAARTFREKLAAGEEELIPAEFVNRMIDGENKIKVWRDYRGMSAK
ALAEAAGISAAYLSQIEKGAREGSLDAMKKIAGALCVTIDELV
MNVQIIKTPQGEEMAVLPKADYDKLLEAFEDREDIAAARTFREKLAAGEEELIPAEFVNRMIDGENKIKVWRDYRGMSAK
ALAEAAGISAAYLSQIEKGAREGSLDAMKKIAGALCVTIDELV
Download Length: 372 bp