Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-HTH_26
Location 3916664..3917301 Replicon chromosome
Accession NZ_CP110339
Organism Brucella sp. JSBI001

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag LJ361_RS18625 Protein ID WP_151657858.1
Coordinates 3916664..3916918 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag LJ361_RS18630 Protein ID WP_151657857.1
Coordinates 3916930..3917301 (+) Length 124 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LJ361_RS18595 (LJ361_18595) 3912018..3912308 + 291 WP_063882078.1 hypothetical protein -
LJ361_RS18600 (LJ361_18600) 3912301..3912861 + 561 WP_063882077.1 hypothetical protein -
LJ361_RS18605 (LJ361_18605) 3912863..3913159 + 297 WP_151657862.1 hypothetical protein -
LJ361_RS18610 (LJ361_18610) 3913175..3915391 + 2217 WP_151657861.1 AAA family ATPase -
LJ361_RS18615 (LJ361_18615) 3915388..3915804 + 417 WP_151657860.1 hypothetical protein -
LJ361_RS18620 (LJ361_18620) 3916080..3916643 + 564 WP_151657859.1 hypothetical protein -
LJ361_RS18625 (LJ361_18625) 3916664..3916918 + 255 WP_151657858.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LJ361_RS18630 (LJ361_18630) 3916930..3917301 + 372 WP_151657857.1 helix-turn-helix transcriptional regulator Antitoxin
LJ361_RS18635 (LJ361_18635) 3917314..3917892 + 579 WP_151657856.1 hypothetical protein -
LJ361_RS18640 (LJ361_18640) 3917933..3918613 + 681 WP_151657855.1 SOS response-associated peptidase -
LJ361_RS18645 (LJ361_18645) 3918657..3918872 + 216 WP_151657854.1 hypothetical protein -
LJ361_RS18650 (LJ361_18650) 3918990..3919355 - 366 WP_151657853.1 thermonuclease family protein -
LJ361_RS18655 (LJ361_18655) 3919760..3919951 - 192 WP_151657851.1 hypothetical protein -
LJ361_RS18660 (LJ361_18660) 3920090..3920332 - 243 WP_151657850.1 HTH domain-containing protein -
LJ361_RS18665 (LJ361_18665) 3920325..3920780 - 456 WP_151657849.1 hypothetical protein -
LJ361_RS18670 (LJ361_18670) 3920791..3921468 - 678 WP_264812082.1 hypothetical protein -
LJ361_RS18675 (LJ361_18675) 3921468..3921821 - 354 WP_151657847.1 hypothetical protein -
LJ361_RS18680 (LJ361_18680) 3921818..3922204 - 387 WP_151657846.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3899608..3950822 51214


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-80)

Antitoxin

Cro/C1-type helix-turn-helix domain

(71-122)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9344.85 Da        Isoelectric Point: 10.2211

>T263619 WP_151657858.1 NZ_CP110339:3916664-3916918 [Brucella sp. JSBI001]
MEQITYSREATKTLIKMPANTAKLIRSKIEQYAADPASLANNVKALKGGEGLLRLRVGDWRVIFTEDGRIIEVIRIAPRG
GAYE

Download         Length: 255 bp

Antitoxin


Download         Length: 124 a.a.        Molecular weight: 13532.54 Da        Isoelectric Point: 4.4987

>AT263619 WP_151657857.1 NZ_CP110339:3916930-3917301 [Brucella sp. JSBI001]
MNVQIIKTPQGEEMAVLPKADYDKLLEAFEDREDIAAARTFREKLAAGEEELIPAEFVNRMIDGENKIKVWRDYRGMSAK
ALAEAAGISAAYLSQIEKGAREGSLDAMKKIAGALCVTIDELV

Download         Length: 372 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References