Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2207474..2208105 | Replicon | chromosome |
| Accession | NZ_CP110339 | ||
| Organism | Brucella sp. JSBI001 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | LJ361_RS10435 | Protein ID | WP_151614776.1 |
| Coordinates | 2207474..2207875 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A256GGW7 |
| Locus tag | LJ361_RS10440 | Protein ID | WP_010660354.1 |
| Coordinates | 2207875..2208105 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LJ361_RS10415 (LJ361_10415) | 2202911..2204431 | - | 1521 | WP_209418708.1 | FAD-dependent oxidoreductase | - |
| LJ361_RS10420 (LJ361_10420) | 2204561..2205502 | - | 942 | WP_226622753.1 | LysR substrate-binding domain-containing protein | - |
| LJ361_RS10425 (LJ361_10425) | 2205627..2206787 | - | 1161 | WP_029928521.1 | mandelate racemase/muconate lactonizing enzyme family protein | - |
| LJ361_RS10430 (LJ361_10430) | 2206816..2207070 | - | 255 | WP_029928523.1 | hypothetical protein | - |
| LJ361_RS10435 (LJ361_10435) | 2207474..2207875 | - | 402 | WP_151614776.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| LJ361_RS10440 (LJ361_10440) | 2207875..2208105 | - | 231 | WP_010660354.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| LJ361_RS10445 (LJ361_10445) | 2208767..2209820 | + | 1054 | Protein_2061 | GSU2403 family nucleotidyltransferase fold protein | - |
| LJ361_RS10450 (LJ361_10450) | 2210194..2210730 | + | 537 | WP_010660385.1 | AAA family ATPase | - |
| LJ361_RS10455 (LJ361_10455) | 2211196..2211810 | - | 615 | WP_010660386.1 | cysteine hydrolase family protein | - |
| LJ361_RS10460 (LJ361_10460) | 2211837..2212886 | + | 1050 | WP_235907984.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2193810..2226266 | 32456 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15000.06 Da Isoelectric Point: 6.4799
>T263618 WP_151614776.1 NZ_CP110339:c2207875-2207474 [Brucella sp. JSBI001]
MLKYMLDTNICIFTIKNRPQQVREAFNRFHDQLCISSVSLMELIYGAEKSAHPEKNLAVVEGFAARLEVLSYDEPAANHT
GQLRAELARSGTPIGPYDQLIAGHARSRGLIIVTNNRTEFDRVPGLRVEDWTD
MLKYMLDTNICIFTIKNRPQQVREAFNRFHDQLCISSVSLMELIYGAEKSAHPEKNLAVVEGFAARLEVLSYDEPAANHT
GQLRAELARSGTPIGPYDQLIAGHARSRGLIIVTNNRTEFDRVPGLRVEDWTD
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|