Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 2193613..2194187 | Replicon | chromosome |
| Accession | NZ_CP110339 | ||
| Organism | Brucella sp. JSBI001 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | LJ361_RS10370 | Protein ID | WP_151576612.1 |
| Coordinates | 2193810..2194187 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A849KU45 |
| Locus tag | LJ361_RS10365 | Protein ID | WP_010660355.1 |
| Coordinates | 2193613..2193813 (+) | Length | 67 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LJ361_RS10350 (LJ361_10350) | 2189233..2189826 | - | 594 | WP_010660339.1 | biliverdin-producing heme oxygenase | - |
| LJ361_RS10355 (LJ361_10355) | 2189877..2190605 | - | 729 | WP_010660340.1 | Crp/Fnr family transcriptional regulator | - |
| LJ361_RS10360 (LJ361_10360) | 2190868..2193402 | + | 2535 | WP_010660341.1 | HWE histidine kinase domain-containing protein | - |
| LJ361_RS10365 (LJ361_10365) | 2193613..2193813 | + | 201 | WP_010660355.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LJ361_RS10370 (LJ361_10370) | 2193810..2194187 | + | 378 | WP_151576612.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LJ361_RS10375 (LJ361_10375) | 2194441..2195370 | - | 930 | WP_151614781.1 | LysR family transcriptional regulator | - |
| LJ361_RS10380 (LJ361_10380) | 2195481..2196185 | + | 705 | WP_151607228.1 | HAD-IA family hydrolase | - |
| LJ361_RS10385 (LJ361_10385) | 2196214..2197509 | + | 1296 | WP_209418706.1 | FAD-binding oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13988.20 Da Isoelectric Point: 7.0615
>T263617 WP_151576612.1 NZ_CP110339:2193810-2194187 [Brucella sp. JSBI001]
VILADTSIWIDHFRRGDNDLVKIIGNDLLLCHPAVIGELALGSLRDRTAVLTFLRAQRETIVATHDEVMTLIERHSVFSM
GIGYTDAHLLASVLLDQRTSLWTRDKRLKLAALKAGAALYEPFHN
VILADTSIWIDHFRRGDNDLVKIIGNDLLLCHPAVIGELALGSLRDRTAVLTFLRAQRETIVATHDEVMTLIERHSVFSM
GIGYTDAHLLASVLLDQRTSLWTRDKRLKLAALKAGAALYEPFHN
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|