Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1138084..1138734 Replicon chromosome
Accession NZ_CP110339
Organism Brucella sp. JSBI001

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag LJ361_RS05545 Protein ID WP_264812923.1
Coordinates 1138552..1138734 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag LJ361_RS05540 Protein ID WP_264812922.1
Coordinates 1138084..1138482 (-) Length 133 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LJ361_RS05500 (LJ361_05500) 1133318..1133788 + 471 WP_264812914.1 hypothetical protein -
LJ361_RS05505 (LJ361_05505) 1133785..1134342 + 558 WP_264812915.1 hypothetical protein -
LJ361_RS05510 (LJ361_05510) 1134750..1134956 - 207 WP_264812916.1 hypothetical protein -
LJ361_RS05515 (LJ361_05515) 1135165..1135740 - 576 WP_264812917.1 hypothetical protein -
LJ361_RS05520 (LJ361_05520) 1136008..1136154 + 147 Protein_1088 IS5/IS1182 family transposase -
LJ361_RS05525 (LJ361_05525) 1136336..1136452 - 117 Protein_1089 transposase domain-containing protein -
LJ361_RS05530 (LJ361_05530) 1136494..1137771 - 1278 WP_264812919.1 hypothetical protein -
LJ361_RS05535 (LJ361_05535) 1137819..1138043 + 225 WP_264812921.1 hypothetical protein -
LJ361_RS05540 (LJ361_05540) 1138084..1138482 - 399 WP_264812922.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
LJ361_RS05545 (LJ361_05545) 1138552..1138734 - 183 WP_264812923.1 type II toxin-antitoxin system HicA family toxin Toxin
LJ361_RS05550 (LJ361_05550) 1139082..1139255 + 174 WP_264812926.1 hypothetical protein -
LJ361_RS05555 (LJ361_05555) 1139329..1139772 + 444 WP_264812928.1 terminase small subunit protein -
LJ361_RS05560 (LJ361_05560) 1139723..1141120 + 1398 WP_264812929.1 phage terminase large subunit -
LJ361_RS05565 (LJ361_05565) 1141098..1141832 - 735 WP_036589688.1 IS21-like element helper ATPase IstB -
LJ361_RS05570 (LJ361_05570) 1141832..1143331 - 1500 WP_036589690.1 IS21 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1124114..1150790 26676


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-124)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6806.98 Da        Isoelectric Point: 10.9561

>T263616 WP_264812923.1 NZ_CP110339:c1138734-1138552 [Brucella sp. JSBI001]
MLRDSKKIVKRLESEGFELISVKGSHHKFRKGDRTVIVPHPKKDLPQGTVKAIAKQAGWE

Download         Length: 183 bp

Antitoxin


Download         Length: 133 a.a.        Molecular weight: 14329.94 Da        Isoelectric Point: 4.2830

>AT263616 WP_264812922.1 NZ_CP110339:c1138482-1138084 [Brucella sp. JSBI001]
MKHYFALVHKDADSAYGIQFPDIPGVFSASDDADDIVKNAIESLQLFAEDEALPDPSSHADIVSRDDVRAELNAGAYLVS
VPFIEDDSAVVRVNVTFERGVLKAIDAVARDRGLTRSSFLAQAARHEIEVGV

Download         Length: 399 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References