Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ygfYX/Cpta(toxin) |
| Location | 3571001..3571643 | Replicon | chromosome |
| Accession | NZ_CP110338 | ||
| Organism | Shewanella algae strain B2215466 | ||
Toxin (Protein)
| Gene name | ygfX | Uniprot ID | A0A5N5U1D5 |
| Locus tag | OLL83_RS16005 | Protein ID | WP_025010549.1 |
| Coordinates | 3571001..3571423 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | ygfY | Uniprot ID | A0A7X5Z2N1 |
| Locus tag | OLL83_RS16010 | Protein ID | WP_028779782.1 |
| Coordinates | 3571404..3571643 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLL83_RS15980 (OLL83_003196) | 3566518..3566997 | - | 480 | WP_071238276.1 | SoxR reducing system RseC family protein | - |
| OLL83_RS15985 (OLL83_003197) | 3567008..3567940 | - | 933 | WP_025887844.1 | MucB/RseB C-terminal domain-containing protein | - |
| OLL83_RS15990 (OLL83_003198) | 3567950..3568570 | - | 621 | WP_208172601.1 | RseA family anti-sigma factor | - |
| OLL83_RS15995 (OLL83_003199) | 3568595..3569173 | - | 579 | WP_025010551.1 | RNA polymerase sigma factor RpoE | - |
| OLL83_RS16000 (OLL83_003200) | 3569373..3570983 | + | 1611 | WP_025010550.1 | L-aspartate oxidase | - |
| OLL83_RS16005 (OLL83_003201) | 3571001..3571423 | - | 423 | WP_025010549.1 | protein YgfX | Toxin |
| OLL83_RS16010 (OLL83_003202) | 3571404..3571643 | - | 240 | WP_028779782.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| OLL83_RS16015 (OLL83_003203) | 3571742..3572650 | - | 909 | WP_025010548.1 | transcriptional activator NhaR | - |
| OLL83_RS16020 (OLL83_003204) | 3572667..3573050 | - | 384 | WP_062793820.1 | hypothetical protein | - |
| OLL83_RS16025 (OLL83_003205) | 3573047..3574222 | - | 1176 | WP_025010547.1 | Na+/H+ antiporter NhaA | - |
| OLL83_RS16030 (OLL83_003206) | 3574339..3575133 | - | 795 | WP_264920177.1 | thymidylate synthase | - |
| OLL83_RS16035 (OLL83_003207) | 3575133..3575960 | - | 828 | WP_123116742.1 | prolipoprotein diacylglyceryl transferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16309.86 Da Isoelectric Point: 7.0359
>T263615 WP_025010549.1 NZ_CP110338:c3571423-3571001 [Shewanella algae]
VAGQRHRFQLSSSFSQYLSLTVLAAICLSSFLAWPALDYPFYLLFKYLCLLLMLAGFGLALWRLRCWQLCFWLNELGEGQ
FEPGSSFELSGRPWVSPFVVTFTYQGEDNYGRCWLFADMFDDTDYRHLCRLLLQRSKSAN
VAGQRHRFQLSSSFSQYLSLTVLAAICLSSFLAWPALDYPFYLLFKYLCLLLMLAGFGLALWRLRCWQLCFWLNELGEGQ
FEPGSSFELSGRPWVSPFVVTFTYQGEDNYGRCWLFADMFDDTDYRHLCRLLLQRSKSAN
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|