Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 50615..51282 | Replicon | plasmid pA |
Accession | NZ_CP110316 | ||
Organism | Xanthomonas phaseoli pv. phaseoli strain UnB187 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A3T0G501 |
Locus tag | OM951_RS22710 | Protein ID | WP_022557732.1 |
Coordinates | 50615..51031 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U4M4Z6 |
Locus tag | OM951_RS22715 | Protein ID | WP_022557731.1 |
Coordinates | 51028..51282 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM951_RS22685 (OM951_22685) | 46345..47664 | + | 1320 | WP_022557736.1 | right-handed parallel beta-helix repeat-containing protein | - |
OM951_RS22690 (OM951_22690) | 47791..49083 | + | 1293 | WP_041019649.1 | M12 family metallo-peptidase | - |
OM951_RS22695 (OM951_22695) | 49238..49786 | + | 549 | WP_022557734.1 | DNA topoisomerase | - |
OM951_RS22700 (OM951_22700) | 49835..49972 | + | 138 | Protein_61 | transposase | - |
OM951_RS22705 (OM951_22705) | 50047..50601 | - | 555 | WP_033482006.1 | plasmid pRiA4b ORF-3 family protein | - |
OM951_RS22710 (OM951_22710) | 50615..51031 | - | 417 | WP_022557732.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OM951_RS22715 (OM951_22715) | 51028..51282 | - | 255 | WP_022557731.1 | plasmid stability protein | Antitoxin |
OM951_RS22720 (OM951_22720) | 51494..52087 | + | 594 | WP_022560487.1 | recombinase family protein | - |
OM951_RS22725 (OM951_22725) | 52084..55113 | + | 3030 | WP_022560486.1 | Tn3 family transposase | - |
OM951_RS22730 (OM951_22730) | 55146..55531 | + | 386 | Protein_67 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | virB1 | 1..57743 | 57743 | |
- | inside | IScluster/Tn | - | - | 49835..56687 | 6852 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14833.04 Da Isoelectric Point: 4.6812
>T263613 WP_022557732.1 NZ_CP110316:c51031-50615 [Xanthomonas phaseoli pv. phaseoli]
MIVLDTNVVSEAMKPEPHPSVRTWLNDQAAETLYLSSVTLAELLFGIAALPAGKRKDMLEQALDGLMGLFRDRVLPFDID
AARRYAELAVTAKIGGRGFPTPDGYIAAIAASRGFIVASRDTAPYEAAGVTVINPWEG
MIVLDTNVVSEAMKPEPHPSVRTWLNDQAAETLYLSSVTLAELLFGIAALPAGKRKDMLEQALDGLMGLFRDRVLPFDID
AARRYAELAVTAKIGGRGFPTPDGYIAAIAASRGFIVASRDTAPYEAAGVTVINPWEG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3T0G501 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3T0G545 |