Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 48106..48773 | Replicon | plasmid pA |
| Accession | NZ_CP110314 | ||
| Organism | Xanthomonas phaseoli pv. phaseoli strain BB007a | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A3T0G501 |
| Locus tag | OM954_RS22930 | Protein ID | WP_022557732.1 |
| Coordinates | 48106..48522 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U4M4Z6 |
| Locus tag | OM954_RS22935 | Protein ID | WP_022557731.1 |
| Coordinates | 48519..48773 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM954_RS22905 (OM954_22905) | 43836..45155 | + | 1320 | WP_022557736.1 | right-handed parallel beta-helix repeat-containing protein | - |
| OM954_RS22910 (OM954_22910) | 45282..46574 | + | 1293 | WP_033481893.1 | M12 family metallo-peptidase | - |
| OM954_RS22915 (OM954_22915) | 46729..47277 | + | 549 | WP_022557734.1 | DNA topoisomerase | - |
| OM954_RS22920 (OM954_22920) | 47326..47463 | + | 138 | Protein_57 | transposase | - |
| OM954_RS22925 (OM954_22925) | 47538..48092 | - | 555 | WP_033482006.1 | plasmid pRiA4b ORF-3 family protein | - |
| OM954_RS22930 (OM954_22930) | 48106..48522 | - | 417 | WP_022557732.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OM954_RS22935 (OM954_22935) | 48519..48773 | - | 255 | WP_022557731.1 | plasmid stability protein | Antitoxin |
| OM954_RS22940 (OM954_22940) | 48985..49578 | + | 594 | WP_022560487.1 | recombinase family protein | - |
| OM954_RS22945 (OM954_22945) | 49575..52604 | + | 3030 | WP_022560486.1 | Tn3 family transposase | - |
| OM954_RS22950 (OM954_22950) | 52637..53022 | + | 386 | Protein_63 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | virB1 | 1..58786 | 58786 | |
| - | inside | IScluster/Tn | - | virB1 | 47326..58711 | 11385 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14833.04 Da Isoelectric Point: 4.6812
>T263610 WP_022557732.1 NZ_CP110314:c48522-48106 [Xanthomonas phaseoli pv. phaseoli]
MIVLDTNVVSEAMKPEPHPSVRTWLNDQAAETLYLSSVTLAELLFGIAALPAGKRKDMLEQALDGLMGLFRDRVLPFDID
AARRYAELAVTAKIGGRGFPTPDGYIAAIAASRGFIVASRDTAPYEAAGVTVINPWEG
MIVLDTNVVSEAMKPEPHPSVRTWLNDQAAETLYLSSVTLAELLFGIAALPAGKRKDMLEQALDGLMGLFRDRVLPFDID
AARRYAELAVTAKIGGRGFPTPDGYIAAIAASRGFIVASRDTAPYEAAGVTVINPWEG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3T0G501 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3T0G545 |