Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-StbC
Location 11111..11778 Replicon plasmid pA
Accession NZ_CP110312
Organism Xanthomonas phaseoli pv. phaseoli strain CFBP 7423

Toxin (Protein)


Gene name vapC Uniprot ID A0A3T0G501
Locus tag OM947_RS22485 Protein ID WP_022557732.1
Coordinates 11111..11527 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID U4M4Z6
Locus tag OM947_RS22490 Protein ID WP_022557731.1
Coordinates 11524..11778 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM947_RS22435 (OM947_22435) 6695..6889 - 195 WP_080948835.1 ribbon-helix-helix domain-containing protein -
OM947_RS22440 (OM947_22440) 6945..7199 - 255 WP_039572150.1 hypothetical protein -
OM947_RS22445 (OM947_22445) 7546..7869 + 324 WP_039572152.1 hypothetical protein -
OM947_RS22450 (OM947_22450) 8273..8548 + 276 WP_039572155.1 hypothetical protein -
OM947_RS22455 (OM947_22455) 8569..8859 + 291 WP_127446651.1 hypothetical protein -
OM947_RS22460 (OM947_22460) 9215..9613 + 399 WP_039572158.1 hypothetical protein -
OM947_RS22465 (OM947_22465) 9686..9847 + 162 WP_157926053.1 hypothetical protein -
OM947_RS22470 (OM947_22470) 9844..10083 + 240 WP_039572160.1 hypothetical protein -
OM947_RS22475 (OM947_22475) 10097..10465 + 369 WP_039584310.1 hypothetical protein -
OM947_RS22480 (OM947_22480) 10543..11097 - 555 WP_033482006.1 plasmid pRiA4b ORF-3 family protein -
OM947_RS22485 (OM947_22485) 11111..11527 - 417 WP_022557732.1 type II toxin-antitoxin system VapC family toxin Toxin
OM947_RS22490 (OM947_22490) 11524..11778 - 255 WP_022557731.1 plasmid stability protein Antitoxin
OM947_RS22495 (OM947_22495) 11990..12583 + 594 WP_022560487.1 recombinase family protein -
OM947_RS22500 (OM947_22500) 12580..15609 + 3030 WP_022560486.1 Tn3 family transposase -
OM947_RS22505 (OM947_22505) 15660..15872 + 213 WP_236493382.1 hypothetical protein -
OM947_RS22510 (OM947_22510) 15970..16314 + 345 WP_039572167.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - virB1 1..63744 63744


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14833.04 Da        Isoelectric Point: 4.6812

>T263607 WP_022557732.1 NZ_CP110312:c11527-11111 [Xanthomonas phaseoli pv. phaseoli]
MIVLDTNVVSEAMKPEPHPSVRTWLNDQAAETLYLSSVTLAELLFGIAALPAGKRKDMLEQALDGLMGLFRDRVLPFDID
AARRYAELAVTAKIGGRGFPTPDGYIAAIAASRGFIVASRDTAPYEAAGVTVINPWEG

Download         Length: 417 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9388.80 Da        Isoelectric Point: 8.9326

>AT263607 WP_022557731.1 NZ_CP110312:c11778-11524 [Xanthomonas phaseoli pv. phaseoli]
MAMLTVRNLPDDVHRALRMRAAQNGHSTEAEVREILATAVKPETRVRLGEALAALGRKIGLTNEDFEVFDRVRDKTPAVP
PRLE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3T0G501

Antitoxin

Source ID Structure
AlphaFold DB A0A3T0G545

References