Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-StbC
Location 47814..48481 Replicon plasmid pA
Accession NZ_CP110307
Organism Xanthomonas phaseoli pv. phaseoli strain BB075a

Toxin (Protein)


Gene name vapC Uniprot ID A0A3T0G501
Locus tag OM949_RS22085 Protein ID WP_022557732.1
Coordinates 48065..48481 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID U4M4Z6
Locus tag OM949_RS22080 Protein ID WP_022557731.1
Coordinates 47814..48068 (+) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM949_RS22060 (OM949_22060) 43278..43622 - 345 WP_039572167.1 hypothetical protein -
OM949_RS22065 (OM949_22065) 43720..43932 - 213 WP_236493382.1 hypothetical protein -
OM949_RS22070 (OM949_22070) 43983..47012 - 3030 WP_022560486.1 Tn3 family transposase -
OM949_RS22075 (OM949_22075) 47009..47602 - 594 WP_022560487.1 recombinase family protein -
OM949_RS22080 (OM949_22080) 47814..48068 + 255 WP_022557731.1 plasmid stability protein Antitoxin
OM949_RS22085 (OM949_22085) 48065..48481 + 417 WP_022557732.1 type II toxin-antitoxin system VapC family toxin Toxin
OM949_RS22090 (OM949_22090) 48495..49049 + 555 WP_033482006.1 plasmid pRiA4b ORF-3 family protein -
OM949_RS22095 (OM949_22095) 49127..49495 - 369 WP_039584310.1 hypothetical protein -
OM949_RS22100 (OM949_22100) 49509..49748 - 240 WP_039572160.1 hypothetical protein -
OM949_RS22105 (OM949_22105) 49745..49906 - 162 WP_157926053.1 hypothetical protein -
OM949_RS22110 (OM949_22110) 49979..50377 - 399 WP_039572158.1 hypothetical protein -
OM949_RS22115 (OM949_22115) 50733..51023 - 291 WP_127446651.1 hypothetical protein -
OM949_RS22120 (OM949_22120) 51044..51319 - 276 WP_039572155.1 hypothetical protein -
OM949_RS22125 (OM949_22125) 51723..52046 - 324 WP_039572152.1 hypothetical protein -
OM949_RS22130 (OM949_22130) 52393..52647 + 255 WP_039572150.1 hypothetical protein -
OM949_RS22135 (OM949_22135) 52703..52897 + 195 WP_080948835.1 ribbon-helix-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - virB1 1..67475 67475


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14833.04 Da        Isoelectric Point: 4.6812

>T263603 WP_022557732.1 NZ_CP110307:48065-48481 [Xanthomonas phaseoli pv. phaseoli]
MIVLDTNVVSEAMKPEPHPSVRTWLNDQAAETLYLSSVTLAELLFGIAALPAGKRKDMLEQALDGLMGLFRDRVLPFDID
AARRYAELAVTAKIGGRGFPTPDGYIAAIAASRGFIVASRDTAPYEAAGVTVINPWEG

Download         Length: 417 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9388.80 Da        Isoelectric Point: 8.9326

>AT263603 WP_022557731.1 NZ_CP110307:47814-48068 [Xanthomonas phaseoli pv. phaseoli]
MAMLTVRNLPDDVHRALRMRAAQNGHSTEAEVREILATAVKPETRVRLGEALAALGRKIGLTNEDFEVFDRVRDKTPAVP
PRLE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3T0G501

Antitoxin

Source ID Structure
AlphaFold DB A0A3T0G545

References