Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 65336..65880 | Replicon | chromosome |
Accession | NZ_CP110301 | ||
Organism | Xanthomonas citri pv. fuscans strain CFBP 6533 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OM953_RS00280 | Protein ID | WP_005912562.1 |
Coordinates | 65602..65880 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OM953_RS00275 | Protein ID | WP_099802649.1 |
Coordinates | 65336..65593 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM953_RS00260 (OM953_00260) | 60456..61937 | - | 1482 | WP_264684734.1 | ribonuclease H-like domain-containing protein | - |
OM953_RS00265 (OM953_00265) | 61934..64429 | - | 2496 | WP_162808326.1 | DEAD/DEAH box helicase | - |
OM953_RS00270 (OM953_00270) | 64607..65269 | + | 663 | WP_162808327.1 | hemolysin III family protein | - |
OM953_RS00275 (OM953_00275) | 65336..65593 | + | 258 | WP_099802649.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OM953_RS00280 (OM953_00280) | 65602..65880 | + | 279 | WP_005912562.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OM953_RS00290 (OM953_00290) | 66060..66959 | - | 900 | WP_007973076.1 | SDR family NAD(P)-dependent oxidoreductase | - |
OM953_RS00295 (OM953_00295) | 67019..67756 | - | 738 | WP_099802650.1 | SDR family oxidoreductase | - |
OM953_RS00300 (OM953_00300) | 67882..68793 | + | 912 | WP_099802651.1 | LysR family transcriptional regulator | - |
OM953_RS00305 (OM953_00305) | 68994..69704 | + | 711 | WP_099802652.1 | hypothetical protein | - |
OM953_RS00310 (OM953_00310) | 69930..70406 | + | 477 | WP_099802653.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10415.00 Da Isoelectric Point: 10.1557
>T263593 WP_005912562.1 NZ_CP110301:65602-65880 [Xanthomonas citri pv. fuscans]
VPALADLDAIADYIAIDNAPAAAALVKRVFAHVEQLIEHPDSGSRPQELKRSRYRQIVEPPCRVFYRVDGQRIVVVHVMR
SERALRGNRLSR
VPALADLDAIADYIAIDNAPAAAALVKRVFAHVEQLIEHPDSGSRPQELKRSRYRQIVEPPCRVFYRVDGQRIVVVHVMR
SERALRGNRLSR
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|