Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 40099..40766 | Replicon | plasmid pA |
Accession | NZ_CP110300 | ||
Organism | Xanthomonas citri pv. fuscans strain BRM48906 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A3T0G501 |
Locus tag | OM948_RS22455 | Protein ID | WP_022557732.1 |
Coordinates | 40350..40766 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U4M4Z6 |
Locus tag | OM948_RS22450 | Protein ID | WP_022557731.1 |
Coordinates | 40099..40353 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM948_RS22435 (OM948_22435) | 35277..36235 | - | 959 | Protein_36 | IS3-like element ISXcd1 family transposase | - |
OM948_RS22440 (OM948_22440) | 36268..39297 | - | 3030 | WP_022560486.1 | Tn3 family transposase | - |
OM948_RS22445 (OM948_22445) | 39294..39887 | - | 594 | WP_022560487.1 | recombinase family protein | - |
OM948_RS22450 (OM948_22450) | 40099..40353 | + | 255 | WP_022557731.1 | plasmid stability protein | Antitoxin |
OM948_RS22455 (OM948_22455) | 40350..40766 | + | 417 | WP_022557732.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OM948_RS22460 (OM948_22460) | 40780..41334 | + | 555 | WP_033482006.1 | plasmid pRiA4b ORF-3 family protein | - |
OM948_RS22465 (OM948_22465) | 41409..41546 | - | 138 | Protein_42 | transposase | - |
OM948_RS22470 (OM948_22470) | 41595..42143 | - | 549 | WP_022557734.1 | DNA topoisomerase | - |
OM948_RS22475 (OM948_22475) | 42298..43590 | - | 1293 | WP_033481893.1 | M12 family metallo-peptidase | - |
OM948_RS22480 (OM948_22480) | 43717..45036 | - | 1320 | WP_022557736.1 | right-handed parallel beta-helix repeat-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..57068 | 57068 | |
- | inside | IScluster/Tn | - | - | 35277..41546 | 6269 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14833.04 Da Isoelectric Point: 4.6812
>T263592 WP_022557732.1 NZ_CP110300:40350-40766 [Xanthomonas citri pv. fuscans]
MIVLDTNVVSEAMKPEPHPSVRTWLNDQAAETLYLSSVTLAELLFGIAALPAGKRKDMLEQALDGLMGLFRDRVLPFDID
AARRYAELAVTAKIGGRGFPTPDGYIAAIAASRGFIVASRDTAPYEAAGVTVINPWEG
MIVLDTNVVSEAMKPEPHPSVRTWLNDQAAETLYLSSVTLAELLFGIAALPAGKRKDMLEQALDGLMGLFRDRVLPFDID
AARRYAELAVTAKIGGRGFPTPDGYIAAIAASRGFIVASRDTAPYEAAGVTVINPWEG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3T0G501 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3T0G545 |