Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 4830537..4831081 | Replicon | chromosome |
| Accession | NZ_CP110298 | ||
| Organism | Xanthomonas citri pv. fuscans strain BRM48906 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OM948_RS20870 | Protein ID | WP_005912562.1 |
| Coordinates | 4830537..4830815 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OM948_RS20875 | Protein ID | WP_099802649.1 |
| Coordinates | 4830824..4831081 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM948_RS20840 (OM948_20840) | 4826011..4826487 | - | 477 | WP_099802653.1 | hypothetical protein | - |
| OM948_RS20845 (OM948_20845) | 4826713..4827423 | - | 711 | WP_099802652.1 | hypothetical protein | - |
| OM948_RS20850 (OM948_20850) | 4827624..4828535 | - | 912 | WP_099802651.1 | LysR family transcriptional regulator | - |
| OM948_RS20855 (OM948_20855) | 4828661..4829398 | + | 738 | WP_099802650.1 | SDR family oxidoreductase | - |
| OM948_RS20860 (OM948_20860) | 4829458..4830357 | + | 900 | WP_007973076.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| OM948_RS20870 (OM948_20870) | 4830537..4830815 | - | 279 | WP_005912562.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OM948_RS20875 (OM948_20875) | 4830824..4831081 | - | 258 | WP_099802649.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OM948_RS20880 (OM948_20880) | 4831148..4831810 | - | 663 | WP_162808327.1 | hemolysin III family protein | - |
| OM948_RS20885 (OM948_20885) | 4831988..4834483 | + | 2496 | WP_162808326.1 | DEAD/DEAH box helicase | - |
| OM948_RS20890 (OM948_20890) | 4834480..4835955 | + | 1476 | WP_099802648.1 | ribonuclease H-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10415.00 Da Isoelectric Point: 10.1557
>T263591 WP_005912562.1 NZ_CP110298:c4830815-4830537 [Xanthomonas citri pv. fuscans]
VPALADLDAIADYIAIDNAPAAAALVKRVFAHVEQLIEHPDSGSRPQELKRSRYRQIVEPPCRVFYRVDGQRIVVVHVMR
SERALRGNRLSR
VPALADLDAIADYIAIDNAPAAAALVKRVFAHVEQLIEHPDSGSRPQELKRSRYRQIVEPPCRVFYRVDGQRIVVVHVMR
SERALRGNRLSR
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|