Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 18514..19181 | Replicon | plasmid pA |
| Accession | NZ_CP110297 | ||
| Organism | Xanthomonas citri pv. fuscans strain LNPV 30.30 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A3T0G501 |
| Locus tag | OM946_RS22050 | Protein ID | WP_022557732.1 |
| Coordinates | 18514..18930 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U4M4Z6 |
| Locus tag | OM946_RS22055 | Protein ID | WP_022557731.1 |
| Coordinates | 18927..19181 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM946_RS22025 (OM946_22025) | 14244..15563 | + | 1320 | WP_022557736.1 | right-handed parallel beta-helix repeat-containing protein | - |
| OM946_RS22030 (OM946_22030) | 15690..16982 | + | 1293 | WP_033481893.1 | M12 family metallo-peptidase | - |
| OM946_RS22035 (OM946_22035) | 17137..17685 | + | 549 | WP_022557734.1 | DNA topoisomerase | - |
| OM946_RS22040 (OM946_22040) | 17734..17871 | + | 138 | Protein_19 | transposase | - |
| OM946_RS22045 (OM946_22045) | 17946..18500 | - | 555 | WP_033482006.1 | plasmid pRiA4b ORF-3 family protein | - |
| OM946_RS22050 (OM946_22050) | 18514..18930 | - | 417 | WP_022557732.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OM946_RS22055 (OM946_22055) | 18927..19181 | - | 255 | WP_022557731.1 | plasmid stability protein | Antitoxin |
| OM946_RS22060 (OM946_22060) | 19393..19986 | + | 594 | WP_022560487.1 | recombinase family protein | - |
| OM946_RS22065 (OM946_22065) | 19983..23012 | + | 3030 | WP_022560486.1 | Tn3 family transposase | - |
| OM946_RS22070 (OM946_22070) | 23045..24003 | + | 959 | Protein_25 | IS3-like element ISXcd1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..57069 | 57069 | |
| - | inside | IScluster/Tn | - | - | 17734..24003 | 6269 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14833.04 Da Isoelectric Point: 4.6812
>T263588 WP_022557732.1 NZ_CP110297:c18930-18514 [Xanthomonas citri pv. fuscans]
MIVLDTNVVSEAMKPEPHPSVRTWLNDQAAETLYLSSVTLAELLFGIAALPAGKRKDMLEQALDGLMGLFRDRVLPFDID
AARRYAELAVTAKIGGRGFPTPDGYIAAIAASRGFIVASRDTAPYEAAGVTVINPWEG
MIVLDTNVVSEAMKPEPHPSVRTWLNDQAAETLYLSSVTLAELLFGIAALPAGKRKDMLEQALDGLMGLFRDRVLPFDID
AARRYAELAVTAKIGGRGFPTPDGYIAAIAASRGFIVASRDTAPYEAAGVTVINPWEG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3T0G501 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3T0G545 |