Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 65331..65875 | Replicon | chromosome |
| Accession | NZ_CP110296 | ||
| Organism | Xanthomonas citri pv. fuscans strain LNPV 30.30 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OM946_RS00280 | Protein ID | WP_005912562.1 |
| Coordinates | 65597..65875 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OM946_RS00275 | Protein ID | WP_099802649.1 |
| Coordinates | 65331..65588 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM946_RS00260 (OM946_00260) | 60457..61932 | - | 1476 | WP_099802648.1 | ribonuclease H-like domain-containing protein | - |
| OM946_RS00265 (OM946_00265) | 61929..64424 | - | 2496 | WP_162808326.1 | DEAD/DEAH box helicase | - |
| OM946_RS00270 (OM946_00270) | 64602..65264 | + | 663 | WP_162808327.1 | hemolysin III family protein | - |
| OM946_RS00275 (OM946_00275) | 65331..65588 | + | 258 | WP_099802649.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OM946_RS00280 (OM946_00280) | 65597..65875 | + | 279 | WP_005912562.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OM946_RS00290 (OM946_00290) | 66055..66954 | - | 900 | WP_007973076.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| OM946_RS00295 (OM946_00295) | 67014..67751 | - | 738 | WP_099802650.1 | SDR family oxidoreductase | - |
| OM946_RS00300 (OM946_00300) | 67877..68788 | + | 912 | WP_099802651.1 | LysR family transcriptional regulator | - |
| OM946_RS00305 (OM946_00305) | 68989..69699 | + | 711 | WP_099802652.1 | hypothetical protein | - |
| OM946_RS00310 (OM946_00310) | 69925..70401 | + | 477 | WP_099802653.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10415.00 Da Isoelectric Point: 10.1557
>T263585 WP_005912562.1 NZ_CP110296:65597-65875 [Xanthomonas citri pv. fuscans]
VPALADLDAIADYIAIDNAPAAAALVKRVFAHVEQLIEHPDSGSRPQELKRSRYRQIVEPPCRVFYRVDGQRIVVVHVMR
SERALRGNRLSR
VPALADLDAIADYIAIDNAPAAAALVKRVFAHVEQLIEHPDSGSRPQELKRSRYRQIVEPPCRVFYRVDGQRIVVVHVMR
SERALRGNRLSR
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|