Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 504338..504909 | Replicon | chromosome |
Accession | NZ_CP110294 | ||
Organism | Enterococcus faecium strain AKSZ-47 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q3Y2B8 |
Locus tag | MZO30_RS03540 | Protein ID | WP_002286801.1 |
Coordinates | 504568..504909 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | MZO30_RS03535 | Protein ID | WP_002323011.1 |
Coordinates | 504338..504568 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MZO30_RS03510 (MZO30_03510) | 499581..500912 | + | 1332 | WP_002286818.1 | FAD-containing oxidoreductase | - |
MZO30_RS03515 (MZO30_03515) | 500934..501560 | + | 627 | WP_002333420.1 | cysteine hydrolase | - |
MZO30_RS03520 (MZO30_03520) | 501743..502324 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
MZO30_RS03525 (MZO30_03525) | 502933..503508 | + | 576 | WP_002293673.1 | SOS response-associated peptidase family protein | - |
MZO30_RS03530 (MZO30_03530) | 503713..504051 | - | 339 | WP_002286804.1 | hypothetical protein | - |
MZO30_RS03535 (MZO30_03535) | 504338..504568 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
MZO30_RS03540 (MZO30_03540) | 504568..504909 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
MZO30_RS03545 (MZO30_03545) | 505759..505944 | + | 186 | WP_002304207.1 | hypothetical protein | - |
MZO30_RS03550 (MZO30_03550) | 506449..506643 | + | 195 | WP_002295146.1 | hypothetical protein | - |
MZO30_RS03555 (MZO30_03555) | 506834..507083 | + | 250 | Protein_480 | transposase | - |
MZO30_RS03560 (MZO30_03560) | 507327..508157 | - | 831 | WP_265465218.1 | manganese catalase family protein | - |
MZO30_RS03565 (MZO30_03565) | 508365..509699 | + | 1335 | WP_002333419.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T263584 WP_002286801.1 NZ_CP110294:504568-504909 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FD66 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZZN9 |