Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 68791..69362 Replicon plasmid unnamed1
Accession NZ_CP110290
Organism Enterococcus faecalis strain AKSZ-208

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag MZO28_RS14335 Protein ID WP_002362432.1
Coordinates 68791..69132 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag MZO28_RS14340 Protein ID WP_002362431.1
Coordinates 69132..69362 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MZO28_RS14310 (MZO28_14310) 64283..64555 + 273 WP_002358664.1 DUF3892 domain-containing protein -
MZO28_RS14315 (MZO28_14315) 64971..65321 - 351 WP_241233782.1 hypothetical protein -
MZO28_RS14320 (MZO28_14320) 65374..66333 - 960 WP_002362389.1 IS30-like element IS6770 family transposase -
MZO28_RS14325 (MZO28_14325) 66874..67476 - 603 WP_002362434.1 Fic family protein -
MZO28_RS14330 (MZO28_14330) 67741..68679 - 939 WP_002362433.1 hypothetical protein -
MZO28_RS14335 (MZO28_14335) 68791..69132 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
MZO28_RS14340 (MZO28_14340) 69132..69362 - 231 WP_002362431.1 hypothetical protein Antitoxin
MZO28_RS14345 (MZO28_14345) 69566..70186 + 621 WP_002367784.1 recombinase family protein -
MZO28_RS14350 (MZO28_14350) 70176..70490 + 315 WP_002367785.1 hypothetical protein -
MZO28_RS14355 (MZO28_14355) 70484..70690 + 207 WP_002367786.1 hypothetical protein -
MZO28_RS14360 (MZO28_14360) 70850..71044 + 195 WP_002367787.1 hypothetical protein -
MZO28_RS14365 (MZO28_14365) 71056..71247 + 192 WP_002367788.1 hypothetical protein -
MZO28_RS14370 (MZO28_14370) 71417..71632 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
MZO28_RS14375 (MZO28_14375) 71633..71974 + 342 WP_002367792.1 bacteriocin immunity protein -
MZO28_RS14380 (MZO28_14380) 72390..72908 + 519 WP_002367793.1 hypothetical protein -
MZO28_RS14385 (MZO28_14385) 72856..73071 + 216 WP_002415356.1 hypothetical protein -
MZO28_RS14390 (MZO28_14390) 73163..73249 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
MZO28_RS14395 (MZO28_14395) 73506..73802 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(L) / tet(M) / str - 1..76918 76918


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T263582 WP_002362432.1 NZ_CP110290:c69132-68791 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT263582 WP_002362431.1 NZ_CP110290:c69362-69132 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References