Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2723955..2724526 | Replicon | chromosome |
Accession | NZ_CP110289 | ||
Organism | Enterococcus faecalis strain AKSZ-208 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | MZO28_RS13505 | Protein ID | WP_002354774.1 |
Coordinates | 2723955..2724296 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3JGB1 |
Locus tag | MZO28_RS13510 | Protein ID | WP_002354773.1 |
Coordinates | 2724296..2724526 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MZO28_RS13500 (2719970) | 2719970..2723584 | - | 3615 | WP_265453594.1 | DNA-directed RNA polymerase subunit beta | - |
MZO28_RS13505 (2723955) | 2723955..2724296 | - | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
MZO28_RS13510 (2724296) | 2724296..2724526 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
MZO28_RS13515 (2724857) | 2724857..2725072 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
MZO28_RS13520 (2725211) | 2725211..2726203 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
MZO28_RS13525 (2726467) | 2726467..2727105 | - | 639 | WP_073438309.1 | lytic polysaccharide monooxygenase | - |
MZO28_RS13530 (2727791) | 2727791..2729407 | + | 1617 | WP_002406969.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T263570 WP_002354774.1 NZ_CP110289:c2724296-2723955 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|