Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 414121..414703 | Replicon | chromosome |
Accession | NZ_CP110289 | ||
Organism | Enterococcus faecalis strain AKSZ-208 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | A0A0M2AE74 |
Locus tag | MZO28_RS02475 | Protein ID | WP_002355414.1 |
Coordinates | 414395..414703 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | MZO28_RS02470 | Protein ID | WP_002326825.1 |
Coordinates | 414121..414393 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MZO28_RS02450 (409802) | 409802..411478 | + | 1677 | WP_010709001.1 | type IA DNA topoisomerase | - |
MZO28_RS02460 (412964) | 412964..413818 | + | 855 | WP_015212161.1 | ParA family protein | - |
MZO28_RS02465 (413889) | 413889..414104 | + | 216 | WP_002355411.1 | peptide-binding protein | - |
MZO28_RS02470 (414121) | 414121..414393 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
MZO28_RS02475 (414395) | 414395..414703 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
MZO28_RS02480 (414783) | 414783..415205 | - | 423 | WP_080005963.1 | tyrosine-type recombinase/integrase | - |
MZO28_RS02485 (415256) | 415256..415756 | - | 501 | WP_002355415.1 | HAD family hydrolase | - |
MZO28_RS02490 (415761) | 415761..416528 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
MZO28_RS02495 (417017) | 417017..417442 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
MZO28_RS02500 (417459) | 417459..417974 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
MZO28_RS02505 (417985) | 417985..418917 | + | 933 | WP_002363040.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T263559 WP_002355414.1 NZ_CP110289:414395-414703 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AE74 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |