Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 3490053..3491028 | Replicon | chromosome |
Accession | NZ_CP110287 | ||
Organism | Bacillus anthracis strain DP-B-5747 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A2R2IKP2 |
Locus tag | OM983_RS18280 | Protein ID | WP_002036394.1 |
Coordinates | 3490053..3490790 (+) | Length | 246 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | R8HWP4 |
Locus tag | OM983_RS18285 | Protein ID | WP_000588712.1 |
Coordinates | 3490903..3491028 (+) | Length | 42 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM983_RS18260 (OM983_18260) | 3485781..3486563 | + | 783 | WP_000381787.1 | class I SAM-dependent methyltransferase | - |
OM983_RS18265 (OM983_18265) | 3486685..3488370 | - | 1686 | WP_009879073.1 | alpha-keto acid decarboxylase family protein | - |
OM983_RS18270 (OM983_18270) | 3488477..3488959 | + | 483 | WP_000191911.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
OM983_RS18275 (OM983_18275) | 3489127..3489864 | + | 738 | WP_000594139.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
OM983_RS18280 (OM983_18280) | 3490053..3490790 | + | 738 | WP_002036394.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
OM983_RS18285 (OM983_18285) | 3490903..3491028 | + | 126 | WP_000588712.1 | hypothetical protein | Antitoxin |
OM983_RS18290 (OM983_18290) | 3491105..3491281 | + | 177 | WP_000852614.1 | hypothetical protein | - |
OM983_RS18295 (OM983_18295) | 3491318..3491599 | - | 282 | WP_001041555.1 | hypothetical protein | - |
OM983_RS18300 (OM983_18300) | 3491876..3492112 | - | 237 | WP_001021689.1 | hypothetical protein | - |
OM983_RS18305 (OM983_18305) | 3492249..3492374 | + | 126 | WP_000694311.1 | hypothetical protein | - |
OM983_RS18310 (OM983_18310) | 3492451..3492627 | + | 177 | WP_000808045.1 | stage II sporulation protein SB | - |
OM983_RS18315 (OM983_18315) | 3492771..3494240 | + | 1470 | WP_000287522.1 | beta-Ala-His dipeptidase | - |
OM983_RS18320 (OM983_18320) | 3494804..3495274 | - | 471 | WP_000670597.1 | DUF5065 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28373.03 Da Isoelectric Point: 8.2705
>T263558 WP_002036394.1 NZ_CP110287:3490053-3490790 [Bacillus anthracis]
VISNIRIGLFILAIVFLVLVFFYWRNEELYEEKKQRIRKTWYGLFIVSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
VISNIRIGLFILAIVFLVLVFFYWRNEELYEEKKQRIRKTWYGLFIVSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2R2IKP2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366GQT1 |