Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 1414664..1415306 | Replicon | chromosome |
Accession | NZ_CP110287 | ||
Organism | Bacillus anthracis strain DP-B-5747 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | J8CWW5 |
Locus tag | OM983_RS07510 | Protein ID | WP_000635963.1 |
Coordinates | 1414956..1415306 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | OM983_RS07505 | Protein ID | WP_000004570.1 |
Coordinates | 1414664..1414951 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM983_RS07480 (OM983_07480) | 1409980..1410942 | + | 963 | WP_000961037.1 | UV DNA damage repair endonuclease UvsE | - |
OM983_RS07485 (OM983_07485) | 1410935..1411507 | - | 573 | WP_000906916.1 | rhomboid family intramembrane serine protease | - |
OM983_RS07490 (OM983_07490) | 1411600..1411959 | + | 360 | WP_000635040.1 | holo-ACP synthase | - |
OM983_RS07495 (OM983_07495) | 1412116..1413066 | + | 951 | WP_025388382.1 | outer membrane lipoprotein carrier protein LolA | - |
OM983_RS07500 (OM983_07500) | 1413185..1414354 | + | 1170 | WP_000390596.1 | alanine racemase | - |
OM983_RS07505 (OM983_07505) | 1414664..1414951 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
OM983_RS07510 (OM983_07510) | 1414956..1415306 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
OM983_RS07515 (OM983_07515) | 1415374..1417542 | + | 2169 | WP_000426225.1 | Tex family protein | - |
OM983_RS07520 (OM983_07520) | 1417600..1417716 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
OM983_RS07525 (OM983_07525) | 1417912..1418370 | + | 459 | WP_000344248.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T263557 WP_000635963.1 NZ_CP110287:1414956-1415306 [Bacillus anthracis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4HKE | |
PDB | 7BXY |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |