Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 240342..240984 | Replicon | chromosome |
Accession | NZ_CP110283 | ||
Organism | Bacillus anthracis strain BA754 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | J8CWW5 |
Locus tag | OM985_RS01305 | Protein ID | WP_000635963.1 |
Coordinates | 240634..240984 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | OM985_RS01300 | Protein ID | WP_000004570.1 |
Coordinates | 240342..240629 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM985_RS01275 (OM985_01275) | 235658..236620 | + | 963 | WP_000961037.1 | UV DNA damage repair endonuclease UvsE | - |
OM985_RS01280 (OM985_01280) | 236613..237185 | - | 573 | WP_000906916.1 | rhomboid family intramembrane serine protease | - |
OM985_RS01285 (OM985_01285) | 237278..237637 | + | 360 | WP_000635040.1 | holo-ACP synthase | - |
OM985_RS01290 (OM985_01290) | 237794..238744 | + | 951 | WP_025388382.1 | outer membrane lipoprotein carrier protein LolA | - |
OM985_RS01295 (OM985_01295) | 238863..240032 | + | 1170 | WP_000390596.1 | alanine racemase | - |
OM985_RS01300 (OM985_01300) | 240342..240629 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
OM985_RS01305 (OM985_01305) | 240634..240984 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
OM985_RS01310 (OM985_01310) | 241052..243220 | + | 2169 | WP_000426225.1 | Tex family protein | - |
OM985_RS01315 (OM985_01315) | 243278..243394 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
OM985_RS01320 (OM985_01320) | 243590..244048 | + | 459 | WP_000344248.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T263553 WP_000635963.1 NZ_CP110283:240634-240984 [Bacillus anthracis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4HKE | |
PDB | 7BXY |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |