Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 3732455..3733097 | Replicon | chromosome |
| Accession | NZ_CP110281 | ||
| Organism | Bacillus anthracis strain BA749 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | J8CWW5 |
| Locus tag | OM981_RS19665 | Protein ID | WP_000635963.1 |
| Coordinates | 3732747..3733097 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | OM981_RS19660 | Protein ID | WP_000004570.1 |
| Coordinates | 3732455..3732742 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM981_RS19635 (OM981_19635) | 3727771..3728733 | + | 963 | WP_000961037.1 | UV DNA damage repair endonuclease UvsE | - |
| OM981_RS19640 (OM981_19640) | 3728726..3729298 | - | 573 | WP_000906916.1 | rhomboid family intramembrane serine protease | - |
| OM981_RS19645 (OM981_19645) | 3729391..3729750 | + | 360 | WP_000635040.1 | holo-ACP synthase | - |
| OM981_RS19650 (OM981_19650) | 3729907..3730857 | + | 951 | WP_025388382.1 | outer membrane lipoprotein carrier protein LolA | - |
| OM981_RS19655 (OM981_19655) | 3730976..3732145 | + | 1170 | WP_000390596.1 | alanine racemase | - |
| OM981_RS19660 (OM981_19660) | 3732455..3732742 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| OM981_RS19665 (OM981_19665) | 3732747..3733097 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| OM981_RS19670 (OM981_19670) | 3733165..3735333 | + | 2169 | WP_000426225.1 | Tex family protein | - |
| OM981_RS19675 (OM981_19675) | 3735391..3735507 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| OM981_RS19680 (OM981_19680) | 3735703..3736161 | + | 459 | WP_000344248.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T263552 WP_000635963.1 NZ_CP110281:3732747-3733097 [Bacillus anthracis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4HKE | |
| PDB | 7BXY |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |