Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 579095..580070 | Replicon | chromosome |
Accession | NZ_CP110281 | ||
Organism | Bacillus anthracis strain BA749 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A2R2IKP2 |
Locus tag | OM981_RS03000 | Protein ID | WP_002036394.1 |
Coordinates | 579095..579832 (+) | Length | 246 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | R8HWP4 |
Locus tag | OM981_RS03005 | Protein ID | WP_000588712.1 |
Coordinates | 579945..580070 (+) | Length | 42 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM981_RS02980 (OM981_02980) | 574823..575605 | + | 783 | WP_000381787.1 | class I SAM-dependent methyltransferase | - |
OM981_RS02985 (OM981_02985) | 575727..577412 | - | 1686 | WP_009879073.1 | alpha-keto acid decarboxylase family protein | - |
OM981_RS02990 (OM981_02990) | 577519..578001 | + | 483 | WP_000191911.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
OM981_RS02995 (OM981_02995) | 578169..578906 | + | 738 | WP_000594139.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
OM981_RS03000 (OM981_03000) | 579095..579832 | + | 738 | WP_002036394.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
OM981_RS03005 (OM981_03005) | 579945..580070 | + | 126 | WP_000588712.1 | hypothetical protein | Antitoxin |
OM981_RS03010 (OM981_03010) | 580147..580323 | + | 177 | WP_000852614.1 | hypothetical protein | - |
OM981_RS03015 (OM981_03015) | 580360..580641 | - | 282 | WP_001041555.1 | hypothetical protein | - |
OM981_RS03020 (OM981_03020) | 580918..581154 | - | 237 | WP_001021689.1 | hypothetical protein | - |
OM981_RS03025 (OM981_03025) | 581291..581416 | + | 126 | WP_000694311.1 | hypothetical protein | - |
OM981_RS03030 (OM981_03030) | 581493..581669 | + | 177 | WP_000808045.1 | stage II sporulation protein SB | - |
OM981_RS03035 (OM981_03035) | 581813..583282 | + | 1470 | WP_000287522.1 | beta-Ala-His dipeptidase | - |
OM981_RS03040 (OM981_03040) | 583846..584316 | - | 471 | WP_000670597.1 | DUF5065 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28373.03 Da Isoelectric Point: 8.2705
>T263551 WP_002036394.1 NZ_CP110281:579095-579832 [Bacillus anthracis]
VISNIRIGLFILAIVFLVLVFFYWRNEELYEEKKQRIRKTWYGLFIVSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
VISNIRIGLFILAIVFLVLVFFYWRNEELYEEKKQRIRKTWYGLFIVSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2R2IKP2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366GQT1 |