Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 4497453..4498428 | Replicon | chromosome |
Accession | NZ_CP110279 | ||
Organism | Bacillus anthracis strain 7702 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A2R2IKP2 |
Locus tag | OM984_RS23675 | Protein ID | WP_002036394.1 |
Coordinates | 4497453..4498190 (+) | Length | 246 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | OM984_RS23680 | Protein ID | WP_139870998.1 |
Coordinates | 4498303..4498428 (+) | Length | 42 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM984_RS23655 (OM984_23655) | 4493181..4493963 | + | 783 | WP_000381787.1 | class I SAM-dependent methyltransferase | - |
OM984_RS23660 (OM984_23660) | 4494085..4495770 | - | 1686 | WP_009879073.1 | alpha-keto acid decarboxylase family protein | - |
OM984_RS23665 (OM984_23665) | 4495877..4496359 | + | 483 | WP_000191911.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
OM984_RS23670 (OM984_23670) | 4496527..4497264 | + | 738 | WP_000594139.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
OM984_RS23675 (OM984_23675) | 4497453..4498190 | + | 738 | WP_002036394.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
OM984_RS23680 (OM984_23680) | 4498303..4498428 | + | 126 | WP_139870998.1 | D-alanyl-D-alanine carboxypeptidase | Antitoxin |
OM984_RS23685 (OM984_23685) | 4498505..4498681 | + | 177 | WP_000852614.1 | hypothetical protein | - |
OM984_RS23690 (OM984_23690) | 4498718..4498903 | - | 186 | WP_002036392.1 | hypothetical protein | - |
OM984_RS23695 (OM984_23695) | 4499275..4499511 | - | 237 | WP_001021689.1 | hypothetical protein | - |
OM984_RS23700 (OM984_23700) | 4499648..4499773 | + | 126 | WP_000694311.1 | hypothetical protein | - |
OM984_RS23705 (OM984_23705) | 4499850..4500026 | + | 177 | WP_000808045.1 | stage II sporulation protein SB | - |
OM984_RS23710 (OM984_23710) | 4500170..4501639 | + | 1470 | WP_000287522.1 | beta-Ala-His dipeptidase | - |
OM984_RS23715 (OM984_23715) | 4502203..4502673 | - | 471 | WP_000670597.1 | DUF5065 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28373.03 Da Isoelectric Point: 8.2705
>T263550 WP_002036394.1 NZ_CP110279:4497453-4498190 [Bacillus anthracis]
VISNIRIGLFILAIVFLVLVFFYWRNEELYEEKKQRIRKTWYGLFIVSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
VISNIRIGLFILAIVFLVLVFFYWRNEELYEEKKQRIRKTWYGLFIVSVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSTIIPLEYIEQLNEQRAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|