Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1305929..1306845 | Replicon | chromosome |
Accession | NZ_CP110268 | ||
Organism | Bacillus siamensis strain YB-1631 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | OM992_RS06985 | Protein ID | WP_049628327.1 |
Coordinates | 1306099..1306845 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | OM992_RS06980 | Protein ID | WP_003154807.1 |
Coordinates | 1305929..1306099 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM992_RS06940 (1301169) | 1301169..1302782 | + | 1614 | WP_264820016.1 | hypothetical protein | - |
OM992_RS06945 (1302795) | 1302795..1303175 | + | 381 | WP_064778772.1 | XkdW family protein | - |
OM992_RS06950 (1303179) | 1303179..1303376 | + | 198 | WP_045925711.1 | XkdX family protein | - |
OM992_RS06955 (1303425) | 1303425..1304186 | + | 762 | WP_064778773.1 | hypothetical protein | - |
OM992_RS06960 (1304238) | 1304238..1304501 | + | 264 | WP_031378810.1 | hemolysin XhlA family protein | - |
OM992_RS06965 (1304515) | 1304515..1304778 | + | 264 | WP_064778774.1 | phage holin | - |
OM992_RS06970 (1304792) | 1304792..1305670 | + | 879 | WP_064778775.1 | N-acetylmuramoyl-L-alanine amidase | - |
OM992_RS06975 (1305707) | 1305707..1305832 | - | 126 | WP_141228459.1 | hypothetical protein | - |
OM992_RS06980 (1305929) | 1305929..1306099 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
OM992_RS06985 (1306099) | 1306099..1306845 | - | 747 | WP_049628327.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
OM992_RS06990 (1306952) | 1306952..1307950 | - | 999 | WP_044802872.1 | inorganic phosphate transporter | - |
OM992_RS06995 (1307963) | 1307963..1308580 | - | 618 | WP_032874614.1 | DUF47 domain-containing protein | - |
OM992_RS07000 (1308864) | 1308864..1310180 | - | 1317 | WP_064778778.1 | amino acid permease | - |
OM992_RS07005 (1310502) | 1310502..1311452 | + | 951 | WP_095240851.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29080.53 Da Isoelectric Point: 4.6947
>T263544 WP_049628327.1 NZ_CP110268:c1306845-1306099 [Bacillus siamensis]
MLVFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFSAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLVFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFSAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|