Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 501708..502345 | Replicon | chromosome |
| Accession | NZ_CP110268 | ||
| Organism | Bacillus siamensis strain YB-1631 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | OM992_RS02460 | Protein ID | WP_003156187.1 |
| Coordinates | 501995..502345 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | OM992_RS02455 | Protein ID | WP_003156188.1 |
| Coordinates | 501708..501989 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM992_RS02435 (498073) | 498073..498672 | - | 600 | WP_016937174.1 | rhomboid family intramembrane serine protease | - |
| OM992_RS02440 (498765) | 498765..499130 | + | 366 | WP_095242092.1 | holo-ACP synthase | - |
| OM992_RS02445 (499295) | 499295..500302 | + | 1008 | WP_016937172.1 | outer membrane lipoprotein carrier protein LolA | - |
| OM992_RS02450 (500419) | 500419..501588 | + | 1170 | WP_016937171.1 | alanine racemase | - |
| OM992_RS02455 (501708) | 501708..501989 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| OM992_RS02460 (501995) | 501995..502345 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| OM992_RS02465 (502466) | 502466..503287 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
| OM992_RS02470 (503292) | 503292..503657 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
| OM992_RS02475 (503660) | 503660..504061 | + | 402 | WP_045927020.1 | anti-sigma regulatory factor | - |
| OM992_RS02480 (504073) | 504073..505080 | + | 1008 | WP_016937170.1 | PP2C family protein-serine/threonine phosphatase | - |
| OM992_RS02485 (505144) | 505144..505473 | + | 330 | WP_016937169.1 | anti-sigma factor antagonist | - |
| OM992_RS02490 (505470) | 505470..505952 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
| OM992_RS02495 (505918) | 505918..506706 | + | 789 | WP_016937168.1 | RNA polymerase sigma factor SigB | - |
| OM992_RS02500 (506706) | 506706..507308 | + | 603 | WP_016937167.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T263543 WP_003156187.1 NZ_CP110268:501995-502345 [Bacillus siamensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|