Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 80852..81504 Replicon plasmid pYZ22CS070_1
Accession NZ_CP110266
Organism Klebsiella pneumoniae strain YZ22CS070

Toxin (Protein)


Gene name vagD Uniprot ID A0A8A2Q2K1
Locus tag OMD39_RS25755 Protein ID WP_017901321.1
Coordinates 80852..81277 (-) Length 142 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A853H7M9
Locus tag OMD39_RS25760 Protein ID WP_001261275.1
Coordinates 81274..81504 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMD39_RS25720 76561..76677 + 117 Protein_81 transposase -
OMD39_RS25725 76802..76972 - 171 Protein_82 LysR family transcriptional regulator -
OMD39_RS25730 76983..77210 + 228 Protein_83 IS3 family transposase -
OMD39_RS25735 77302..78858 - 1557 WP_025999314.1 sensor domain-containing diguanylate cyclase -
OMD39_RS25740 79045..79218 - 174 Protein_85 nuclease -
OMD39_RS25745 79271..79807 - 537 Protein_86 integrase core domain-containing protein -
OMD39_RS25750 79866..80834 - 969 WP_236935921.1 IS5 family transposase -
OMD39_RS25755 80852..81277 - 426 WP_017901321.1 type II toxin-antitoxin system VapC family toxin Toxin
OMD39_RS25760 81274..81504 - 231 WP_001261275.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OMD39_RS25765 81757..84333 - 2577 WP_017901322.1 nuclease domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-Ia / blaTEM-1B / aac(3)-IId / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / mph(E) / msr(E) / armA / sul1 / blaDHA-1 / qnrB4 - 1..224600 224600
- flank IS/Tn - - 79866..80834 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 142 a.a.        Molecular weight: 15412.91 Da        Isoelectric Point: 7.1364

>T263542 WP_017901321.1 NZ_CP110266:c81277-80852 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE

Download         Length: 426 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8707.72 Da        Isoelectric Point: 4.3410

>AT263542 WP_001261275.1 NZ_CP110266:c81504-81274 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFDP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8A2Q2K1

Antitoxin

Source ID Structure
AlphaFold DB A0A853H7M9

References