Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
| Location | 4548538..4549264 | Replicon | chromosome |
| Accession | NZ_CP110265 | ||
| Organism | Klebsiella pneumoniae strain YZ22CS070 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | OMD39_RS22270 | Protein ID | WP_032437356.1 |
| Coordinates | 4548538..4548879 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | OMD39_RS22275 | Protein ID | WP_032437354.1 |
| Coordinates | 4548914..4549264 (-) | Length | 117 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMD39_RS22240 (4543545) | 4543545..4544816 | + | 1272 | Protein_4358 | conjugative transfer system coupling protein TraD | - |
| OMD39_RS22245 (4544779) | 4544779..4545045 | + | 267 | WP_004178415.1 | hypothetical protein | - |
| OMD39_RS22250 (4545045) | 4545045..4545717 | + | 673 | Protein_4360 | DUF4400 domain-containing protein | - |
| OMD39_RS22255 (4545728) | 4545728..4546612 | + | 885 | WP_004192285.1 | RES domain-containing protein | - |
| OMD39_RS22260 (4546811) | 4546811..4546999 | - | 189 | Protein_4362 | transposase | - |
| OMD39_RS22265 (4547016) | 4547016..4548127 | - | 1112 | Protein_4363 | IS3 family transposase | - |
| OMD39_RS22270 (4548538) | 4548538..4548879 | - | 342 | WP_032437356.1 | TA system toxin CbtA family protein | Toxin |
| OMD39_RS22275 (4548914) | 4548914..4549264 | - | 351 | WP_032437354.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| OMD39_RS22280 (4549285) | 4549285..4549506 | - | 222 | WP_063931680.1 | DUF987 domain-containing protein | - |
| OMD39_RS22285 (4549522) | 4549522..4549995 | - | 474 | WP_032437352.1 | DNA repair protein RadC | - |
| OMD39_RS22290 (4550066) | 4550066..4550887 | - | 822 | WP_032437350.1 | DUF932 domain-containing protein | - |
| OMD39_RS22295 (4550983) | 4550983..4551660 | - | 678 | WP_032437348.1 | hypothetical protein | - |
| OMD39_RS22300 (4551946) | 4551946..4552839 | - | 894 | WP_032437346.1 | 50S ribosome-binding GTPase | - |
| OMD39_RS22305 (4552937) | 4552937..4554088 | + | 1152 | WP_129075233.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4537825..4576941 | 39116 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12991.04 Da Isoelectric Point: 5.0978
>T263536 WP_032437356.1 NZ_CP110265:c4548879-4548538 [Klebsiella pneumoniae]
MNTLPVINQRAIQLCPSPVTIWQTLLTRLLEQHYGLALNDTPFGDESVIQEHIEAGITLVDAVNFLVEKYELVRIDRWAF
GWLEPSPYLRAEDILRMRRDMGLLRGCNHTAAM
MNTLPVINQRAIQLCPSPVTIWQTLLTRLLEQHYGLALNDTPFGDESVIQEHIEAGITLVDAVNFLVEKYELVRIDRWAF
GWLEPSPYLRAEDILRMRRDMGLLRGCNHTAAM
Download Length: 342 bp
Antitoxin
Download Length: 117 a.a. Molecular weight: 12859.60 Da Isoelectric Point: 6.3108
>AT263536 WP_032437354.1 NZ_CP110265:c4549264-4548914 [Klebsiella pneumoniae]
MSNKTQTVNGDTAEPRWGLSCNVIPCFGARLVQEGNRLHYLADRASITGQFNEADLIHPDQAFPVLLKQAELMLTSGELN
PRHQHCVTFCEKGLTCEADTLGSCGHVYIVIYPTQR
MSNKTQTVNGDTAEPRWGLSCNVIPCFGARLVQEGNRLHYLADRASITGQFNEADLIHPDQAFPVLLKQAELMLTSGELN
PRHQHCVTFCEKGLTCEADTLGSCGHVYIVIYPTQR
Download Length: 351 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|