Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3908425..3909044 Replicon chromosome
Accession NZ_CP110265
Organism Klebsiella pneumoniae strain YZ22CS070

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OMD39_RS19170 Protein ID WP_002892050.1
Coordinates 3908826..3909044 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OMD39_RS19165 Protein ID WP_002892066.1
Coordinates 3908425..3908799 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OMD39_RS19155 (3903577) 3903577..3904770 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OMD39_RS19160 (3904793) 3904793..3907939 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OMD39_RS19165 (3908425) 3908425..3908799 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OMD39_RS19170 (3908826) 3908826..3909044 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OMD39_RS19175 (3909203) 3909203..3909769 + 567 WP_004191639.1 maltose O-acetyltransferase -
OMD39_RS19180 (3909741) 3909741..3909881 - 141 WP_004147370.1 hypothetical protein -
OMD39_RS19185 (3909902) 3909902..3910372 + 471 WP_002892026.1 YlaC family protein -
OMD39_RS19190 (3910347) 3910347..3911798 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OMD39_RS19195 (3911899) 3911899..3912597 + 699 WP_002892021.1 GNAT family protein -
OMD39_RS19200 (3912594) 3912594..3912734 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OMD39_RS19205 (3912734) 3912734..3912997 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T263534 WP_002892050.1 NZ_CP110265:3908826-3909044 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT263534 WP_002892066.1 NZ_CP110265:3908425-3908799 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References