Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1425126..1426042 | Replicon | chromosome |
Accession | NZ_CP110264 | ||
Organism | Bacillus halotolerans strain HMB20199 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A7G7U9Y2 |
Locus tag | OMK57_RS07280 | Protein ID | WP_024121091.1 |
Coordinates | 1425296..1426042 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | A0A7G7U9Y3 |
Locus tag | OMK57_RS07275 | Protein ID | WP_024121090.1 |
Coordinates | 1425126..1425296 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMK57_RS07235 (OMK57_07235) | 1420495..1420767 | + | 273 | WP_044156234.1 | hypothetical protein | - |
OMK57_RS07240 (OMK57_07240) | 1420770..1422737 | + | 1968 | WP_069486429.1 | pyocin knob domain-containing protein | - |
OMK57_RS07245 (OMK57_07245) | 1422751..1423140 | + | 390 | WP_059336104.1 | hypothetical protein | - |
OMK57_RS07250 (OMK57_07250) | 1423182..1423280 | + | 99 | WP_264798417.1 | XkdX family protein | - |
OMK57_RS07255 (OMK57_07255) | 1423409..1423687 | + | 279 | WP_059336102.1 | hemolysin XhlA family protein | - |
OMK57_RS07260 (OMK57_07260) | 1423699..1423962 | + | 264 | WP_024121086.1 | phage holin | - |
OMK57_RS07265 (OMK57_07265) | 1423975..1424868 | + | 894 | WP_059336101.1 | N-acetylmuramoyl-L-alanine amidase | - |
OMK57_RS07270 (OMK57_07270) | 1424905..1425042 | - | 138 | WP_125825426.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
OMK57_RS07275 (OMK57_07275) | 1425126..1425296 | - | 171 | WP_024121090.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
OMK57_RS07280 (OMK57_07280) | 1425296..1426042 | - | 747 | WP_024121091.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
OMK57_RS07285 (OMK57_07285) | 1426151..1427152 | - | 1002 | WP_044156221.1 | inorganic phosphate transporter | - |
OMK57_RS07290 (OMK57_07290) | 1427165..1427782 | - | 618 | WP_044156219.1 | DUF47 domain-containing protein | - |
OMK57_RS07295 (OMK57_07295) | 1428060..1429376 | - | 1317 | WP_059336100.1 | serine/threonine exchanger | - |
OMK57_RS07300 (OMK57_07300) | 1429771..1430721 | + | 951 | WP_069486430.1 | ring-cleaving dioxygenase | - |
OMK57_RS07305 (OMK57_07305) | 1430887..1430967 | + | 81 | Protein_1376 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29076.48 Da Isoelectric Point: 4.4986
>T263524 WP_024121091.1 NZ_CP110264:c1426042-1425296 [Bacillus halotolerans]
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CHYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CHYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7G7U9Y2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7G7U9Y3 |